CAZyme Information: SPBR_02001-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_02001-t41_1-p1
• CAZy Family: CE1
• CAZyme Description: acetyl xylan esterase (Axe1)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220	AWTV01000007|CGC5	22141.99	7.5061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000007:572700-573425(-)

Full Sequence      

MKLTAALPVLAAGLASASPLTCPPVHIFAARETTAPAGYGTSKGLVDMVVRANSGATSEA
IVYPACGGQSSCGGASYDSSASQGTAAVVKAVTALNTQCPDTKIVLIGYSQGGQIMDNAI
CGGAGAALTGAALKAVKAAIFMGDPHNTAGLPYNVGTCTNHGFSARQSGFQCSPGSPSII
QSYCDSQDPYCCNGNDANHHQQYVSIYGQKAAAFIQKLLA

Enzyme Prediction     

EC	3.1.1.72:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	22	217	3.7e-40	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	5.00e-50	22	219	2	173	Cutinase.
369775	PE-PPE	2.32e-04	55	120	2	66	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO67382.1|CE5	3.25e-114	1	219	1	226
QBZ62023.1|CE5	7.64e-106	1	219	1	228
VBB76614.1|CE5	2.11e-105	4	219	5	225
CAP61068.1|CE5	6.04e-105	4	219	5	225
CDP26520.1|CE5	6.04e-105	4	219	5	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	1.82e-76	22	220	2	207	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	8.00e-73	21	219	1	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.13e-72	22	219	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	9.22e-72	21	219	1	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
7CC4_A	2.94e-07	22	178	3	146	Chain A, Cutinase-like enzyme [Moesziomyces antarcticus],7CC4_B Chain B, Cutinase-like enzyme [Moesziomyces antarcticus],7CW1_A Chain A, Cutinase-like enzyme [Moesziomyces antarcticus],7CW1_B Chain B, Cutinase-like enzyme [Moesziomyces antarcticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99034|AXE1_HYPJE	1.92e-74	22	220	33	238	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	4.40e-74	21	219	24	229	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|O59893|AXE2_TALPU	9.83e-72	21	219	28	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q00298|CUTI_BOTFU	7.42e-06	7	147	16	149	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000371	0.999614	CS pos: 17-18. Pr: 0.9631

TMHMM  Annotations     

There is no transmembrane helices in SPBR_02001-t41_1-p1.