CAZyme Information: SPBR_01755-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_01755-t41_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: alpha 1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		43898.48	5.2469

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000007:2316272-2317556(-)

Full Sequence      

MLTFKRALIAAAFFLTVFYITTRSHTTPGAVLLQDQKDAAAAAASSTAAAASQNGPSIAS
QGGSASSSSSGVGAGAGAGAGAGADTHQLGHVGDQKTLHIPDLAKLTLYDKLAYQYPYDV
NKKFPAYIWQTWKYTPANGEFTFREQEATWTEQHPGFIHEVITDAVAVKLLRLLYAAVPE
VLEAYDALPLPVLKADFFRYLILLARGGIYSDIDTYAIRSALEWIPESVPREAIGLVIGI
EADPDRPDWRDWYSRRIQFCQWTIQAKPGHPVLRQIVTHITNETLRLKRAGDTSAFLGNN
VVEFSGPAVWTDVVFGYFNDDRFFDMADSKGPIDWRNFTGMDAPKRVGDVIVLPITSFSP
GVEQMGAKDYDDPMAFVKHDFEGTWKPESERHIGEQQE

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	145	227	2.7e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.10e-41	110	378	68	339	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.85e-18	149	228	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65877.1|GT32	9.95e-189	1	398	1	378
VBB72967.1|GT32	1.94e-187	90	396	70	377
CAP67577.1|GT32	1.23e-181	102	396	83	398
CDP23838.1|GT32	1.23e-181	102	396	83	398
AEO65653.1|GT32	3.71e-181	102	394	87	379

PDB Hits     

SPBR_01755-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.86e-94	96	386	73	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.60e-77	110	386	130	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	4.15e-71	107	386	113	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.38e-67	108	394	80	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.756466	0.243544

TMHMM  Annotations     

There is no transmembrane helices in SPBR_01755-t41_1-p1.