CAZyme Information: SPBR_01748-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_01748-t41_1-p1
• CAZy Family: CBM50
• CAZyme Description: pectinesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	AWTV01000007|CGC11	36181.81	9.3443

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000007:1216076-1217375(-)

Full Sequence      

MLSTLVLSMCIGRAFATGRTSPPSGSITVCSSGCDYNTIQKAVGSISPTSKSPSKIFVYA
GTYTEQVTIPALAGALTIYGQTVNTASYTSNVVNLKWKSSAADGFDDEHTAALINLSPSV
RVYNINIKNTYGKGSQAIALAAYNTKQGYYGVGLYGYQDTLLAQTGNQVYAGCYIEGAVD
FVFGQYARAWITKTDIALKAGGGSITADGRPSASGDSYYVIDQSTVSAASGASVASGTVY
LGRPWSQYARVCVQKTVLSSIVNAAGWSIWSTSTPNTAGVSFQEYDNKGAGASGTRVSFA
TKLSSPILIGTILGSDYASWLLYRWCWLKRALLGLMTAVRRSS

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	303	3.2e-68	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	3.16e-32	27	321	13	292	putative pectinesterase
215357	PLN02665	4.77e-29	35	322	79	361	pectinesterase family protein
395871	Pectinesterase	3.57e-27	27	300	2	275	Pectinesterase.
178113	PLN02497	1.86e-24	26	304	33	307	probable pectinesterase
215117	PLN02176	6.61e-24	5	304	19	314	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA16046.1|CE8	4.60e-131	5	320	5	320
ATZ56871.1|CE8	3.81e-125	5	320	5	320
CCD50540.1|CE8	3.81e-125	5	320	5	320
QSZ32978.1|CE8	9.54e-121	5	320	5	320
ARB08121.1|CE8	9.55e-117	14	320	16	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	6.10e-65	19	321	3	295	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.10e-65	19	321	3	295	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.38e-26	35	293	18	274	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	6.87e-21	35	292	14	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	6.37e-110	3	320	4	324	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.45e-103	3	320	4	325	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q5B7U0|PMEA_EMENI	1.07e-65	17	321	27	321	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.16e-64	17	320	26	319	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.16e-64	17	320	26	319	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000490	0.999454	CS pos: 16-17. Pr: 0.9710

TMHMM  Annotations     

There is no transmembrane helices in SPBR_01748-t41_1-p1.