CAZyme Information: SPBR_01668-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_01668-t41_1-p1
• CAZy Family: CBM21
• CAZyme Description: N-acetylglucosamine-6-phosphate deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		52467.64	6.6466

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000007:2772751-2774220(-)

Full Sequence      

MPSIITSSVPPSPITTTPSSPTAPGTRGITKLTNCRLVRGNDLVWEDLWISSNTGKIVRS
QAAFYDHHVLPDETVDLGGRIVAPGMIECQLNGAFGFNFSTLFGDEDNAAKGQPTTYAKR
LHELNRNLVKTGVTSYVPTVTSQTSELYHKVLPFLAPKRGEAKDGAESLGAHVEGPFLSP
TKNGVHNPEVFREAQTVADVEAMYGAKNLAGDVTDEKRKPAVRMITAAPEIGRMTDIVFP
ELRRRGIVCAIGHSEATYEQAAAAISHGATMITHLFNAMRPLHHRNPGIFGVLGETPLVR
VDTTTSSLEGAVAPSPRPYFGVIADGNHLHPTTVKIAYNAYPAGFILVTDAMHMVGCPDG
PYDWTNGDRHMRLVKNGKVLLLENSDTIAGSTITLIECVENFINWTGATIPQALRTVTST
PAAMLGLQGVKGSLDAGADADLLVLSAEEVLELPTSPTTAAVTGGASVVTTRLHVDEVWK
FGQRVHERK

Enzyme Prediction     

No EC number prediction in SPBR_01668-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE9	32	448	1.4e-113	0.9705093833780161

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238434	NagA	2.26e-120	30	446	1	362	N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate. This is the first committed step in the biosynthetic pathway to amino-sugar-nucleotides, which is needed for cell wall peptidoglycan and teichoic acid biosynthesis. Deacetylation of N-acetylglucosamine is also important in lipopolysaccharide synthesis and cell wall recycling.
224733	NagA	2.78e-92	30	445	2	362	N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism].
272968	nagA	6.70e-63	32	446	7	367	N-acetylglucosamine-6-phosphate deacetylase. [Central intermediary metabolism, Amino sugars]
183010	nagA	1.62e-56	32	446	4	364	N-acetylglucosamine-6-phosphate deacetylase; Provisional
224149	HutI	5.92e-08	407	489	335	404	Imidazolonepropionase or related amidohydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD84625.1|CE9	4.41e-201	20	486	6	432
QBZ62650.1|CE9	6.26e-201	20	486	6	432
AEO64230.1|CE9	1.20e-190	23	488	9	473
UKZ86842.1|CE9	5.31e-190	28	486	14	431
QPG94427.1|CE9	8.99e-190	28	485	16	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NUT_A	1.39e-79	29	445	12	385	Chain A, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUT_B Chain B, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUU_A Chain A, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUU_B Chain B, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens]
3EGJ_A	1.75e-46	32	444	7	362	N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae. [Vibrio cholerae],3EGJ_B N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae. [Vibrio cholerae],3IV8_A N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae complexed with fructose 6-phosphate [Vibrio cholerae],3IV8_B N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae complexed with fructose 6-phosphate [Vibrio cholerae],3IV8_C N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae complexed with fructose 6-phosphate [Vibrio cholerae],3IV8_D N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae complexed with fructose 6-phosphate [Vibrio cholerae]
1YMY_A	5.56e-36	73	470	42	381	Crystal Structure of the N-Acetylglucosamine-6-phosphate deacetylase from Escherichia coli K12 [Escherichia coli K-12],1YMY_B Crystal Structure of the N-Acetylglucosamine-6-phosphate deacetylase from Escherichia coli K12 [Escherichia coli K-12],1YRR_A Crystal Structure Of The N-Acetylglucosamine-6-Phosphate Deacetylase From Escherichia Coli K12 at 2.0 A Resolution [Escherichia coli],1YRR_B Crystal Structure Of The N-Acetylglucosamine-6-Phosphate Deacetylase From Escherichia Coli K12 at 2.0 A Resolution [Escherichia coli],2P50_A Crystal structure of N-acetyl-D-Glucosamine-6-Phosphate deacetylase liganded with Zn [Escherichia coli K-12],2P50_B Crystal structure of N-acetyl-D-Glucosamine-6-Phosphate deacetylase liganded with Zn [Escherichia coli K-12],2P50_C Crystal structure of N-acetyl-D-Glucosamine-6-Phosphate deacetylase liganded with Zn [Escherichia coli K-12],2P50_D Crystal structure of N-acetyl-D-Glucosamine-6-Phosphate deacetylase liganded with Zn [Escherichia coli K-12]
2P53_A	2.77e-35	73	470	42	381	Chain A, N-acetylglucosamine-6-phosphate deacetylase [Escherichia coli K-12],2P53_B Chain B, N-acetylglucosamine-6-phosphate deacetylase [Escherichia coli K-12]
6FV3_A	1.93e-34	76	445	58	376	Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_B Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_C Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_D Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6P0U0|NAGA_DANRE	7.63e-84	29	445	12	385	N-acetylglucosamine-6-phosphate deacetylase OS=Danio rerio OX=7955 GN=amdhd2 PE=2 SV=1
sp|Q8JZV7|NAGA_MOUSE	3.29e-80	29	445	12	385	N-acetylglucosamine-6-phosphate deacetylase OS=Mus musculus OX=10090 GN=Amdhd2 PE=1 SV=1
sp|Q5BJY6|NAGA_RAT	3.61e-79	29	445	12	385	N-acetylglucosamine-6-phosphate deacetylase OS=Rattus norvegicus OX=10116 GN=Amdhd2 PE=3 SV=2
sp|Q9Y303|NAGA_HUMAN	7.16e-79	29	445	12	385	N-acetylglucosamine-6-phosphate deacetylase OS=Homo sapiens OX=9606 GN=AMDHD2 PE=1 SV=2
sp|A7MBC0|NAGA_BOVIN	1.55e-77	29	445	12	385	N-acetylglucosamine-6-phosphate deacetylase OS=Bos taurus OX=9913 GN=AMDHD2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998423	0.001616

TMHMM  Annotations     

There is no transmembrane helices in SPBR_01668-t41_1-p1.