CAZyme Information: SPBR_01666-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_01666-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: phosphatidylinositol glycan, class V

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	AWTV01000007|CGC7	49834.68	9.1701

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000007:882446-883920(+)

Full Sequence      

MTTQSGAAGTAPKAAALLNHTQHPYWSLAVVFGAWKACLLAIAVLAASAGPAYDTSGDLL
QVIASSNGTTPYASSTGGYAIPSGGIVSRLTSWDAIYYVEAARRGHVYEQEWAFGAGLPL
VVSCVRDALARVGVDATVAVVAVAYVHIAHLLAVFALYRLGCQLWEGAAGRTTAFVAACL
HVLSPAGLFLSAPYAESSCALFSFVGYAAFAAGRTQGLSVKGDALRLLAGAAFGVATLFR
SNGLLNGVVFAYEAVHGAITFLQQPSPRLLRRLVSIGLGGLAVAAGSVVPQAVAYFEFCI
EPSGVPGEDRRPWCVQRLPSIYNFVQDHYWGSGRLFNYWTLSNLPLFLLATPMLLIMTRS
GLDLWQAASKTKNDANKKQEHEGTLAPRIAPLLQSMAASQLLLAFMAFTSYHVQIVSRLS
TAYPVWYWWLAQGLSGGPRSRLAGRLVVFIVMYASIQGMLFASFLPPA

Enzyme Prediction     

No EC number prediction in SPBR_01666-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	31	468	6.1e-109	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.02e-38	90	468	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.76e-12	93	468	77	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58925.1|GT76	2.64e-123	23	468	19	458
VBB80094.1|GT76	3.29e-122	24	468	37	461
CDP28476.1|GT76	1.13e-120	24	468	39	463
CAP66741.1|GT76	1.13e-120	24	468	39	463
AEO64180.1|GT76	2.80e-119	24	468	13	455

PDB Hits     

SPBR_01666-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2GSI6|GPI18_CHAGB	4.02e-123	11	468	2	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	2.53e-103	17	468	3	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	3.51e-84	7	468	2	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	2.49e-75	1	468	4	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	9.34e-45	25	468	4	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000032

TMHMM  Annotations     

Start	End
25	47
138	160
173	195
230	252
273	295
335	357
446	465