CAZyme Information: SPBR_01497-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_01497-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: phosphatidylinositol glycan, class Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522	AWTV01000007|CGC4	59735.77	9.2287

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000007:2499202-2501127(-)

Full Sequence      

MWRRTYLVLILVRLWFAMSPSYLHPDENFQGPEVIAGEVFSYPVRLTWEFTSDHPIRSVF
PLWPVYGLPMFLLRWLWIGNGGDGEIPPHVVFWVLRLLMFVMNFVLLDWAIYELVPAKRH
RQTAVVLVASSYVTWTYQTHTFSNSVETLVVAWSLVLIDRIVEGRQDRASVLAPSILGIV
VVFGIFNRITFPAFLLIPGLRLIPYFINRPLSFTALALSGLLTTIVAIAFDTAFYTPHQI
SWGDLLFHPVITPLNNLLYNMSPANLAEHGLHPWYQHLLANIPLLIGPAAALLFLQPHLS
LRLYSAVSGIFVLSIFQHQEARFLLPTIPLILSSVQLPRNSRLLHAWVSAWIAFNVLLGI
LMGVYHQGGIVPTQIFMSRQPDATQAIWWKTYSPPIWLLNGKNEVLQTRDVMGLPGDQLM
EQLTALATCDTPADRRNNEYLKEKNGTYLIAPLSATWLDQYLPNKGLEGLRFREVWRYRQ
HLNLDDLDWGDDGVWNTLSRVVGRRGIAAWRVTKSCPDQRKR

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	398	3.3e-77	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.08e-50	5	397	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	0.010	3	380	39	426	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI65346.1|GT22	8.24e-315	1	516	1	515
AEO57845.1|GT22	3.58e-311	1	522	1	521
UNI14407.1|GT22	4.06e-311	1	516	1	515
ATY60246.1|GT22	2.73e-309	1	516	1	515
UQC77828.1|GT22	2.70e-307	1	516	1	515

PDB Hits     

SPBR_01497-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	1.75e-301	1	517	1	516	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	4.75e-183	1	515	1	540	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	1.44e-180	1	518	1	547	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	9.65e-176	1	510	1	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	1.78e-98	10	488	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000314	0.999640	CS pos: 17-18. Pr: 0.9327

TMHMM  Annotations     

Start	End
59	78
93	115
169	191
211	230
343	365