CAZyme Information: SPBR_01478-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_01478-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: capsule-associated protein CAP1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639		72732.69	6.5980

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000007:2714530-2716506(-)

Full Sequence      

MRSRQFTILGVFAILIICFYSFSHIEQAPYLGPHANGHPATDPAATATPNTPGNTPPTPE
KSLPHPPEVESGHQVPASAPDVQPPASKPKKASHTSHPMWSLISGAESDLEKMKARQSKT
LQEAVAEYRKRYGIAPPPHFDKWFAFAKDNNVQLVDEFDTINELLTPFWGLKPATIRARA
KEALGFGNGLLGLAIRDGNISHIEGGGEWQRDATKGMLRQFIQYLPNMDLCFNVHDEPRV
VVPHEDMARLVATAKGKTMARARANADSPGTLRNQFTAKVKGLGSGNRFEEAALTRFNVF
AHQPTWTHSRMSCPPDSPARALEEGEQRDDVAQYSLSELGFVYNMTALSDICYTPSLRET
FGFFDRPNAYNIVHDLFPIFSQSKVSSYADILYPSPWYWYGKVTYDEARDRPWADKIDQL
YWRGSTTGGFSRDGGWRRQHRQRFVQKINAVDQAMILKNAAADRDGGEQDWQVKEVARAD
FKDLFNVYFSHIGQCDEGDCEAQKQFFEIQDRADQQDAWQYKYLVDLDGNAFSGRFYAFL
QSKSLVYKQAIFREWHYEWLKPWAHYIPLSLRGDDWLETVRFFGDGALGKKEAERLALQS
RDWANNVVRNVDLEAWFFRLLLEYGRVIDDDRESIGFTL

Enzyme Prediction     

No EC number prediction in SPBR_01478-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	355	628	1.1e-80	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.65e-18	374	626	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.91e-11	378	626	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC78507.1|GT90	1.29e-290	88	639	65	610
APA08219.1|GT90	7.81e-283	1	638	48	653
CCD51306.1|GT90	1.11e-282	1	638	48	653
ATZ48502.1|GT90	1.11e-282	1	638	48	653
QSZ35850.1|GT90	2.10e-281	1	638	52	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.49e-06	378	628	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	3.05e-06	355	628	95	342	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.24e-51	90	634	145	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	2.20e-09	370	628	156	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q6UW63|PLGT2_HUMAN	2.68e-08	517	627	358	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q9JHP7|PLGT2_MOUSE	9.96e-07	517	627	358	466	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	3.31e-06	378	628	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.970368	0.029659

TMHMM  Annotations     

Start	End
7	25