CAZyme Information: SPBR_01312-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_01312-t41_1-p1
• CAZy Family: AA8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847		91146.66	6.6104

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000007:3024883-3027743(+)

Full Sequence      

MSQSLQTPSLHKVLAFGAGFLSAVAVTYPHNGRPNRWHHLNHARDIASEYDYVIVGGGTA
GLTVADRLTEDANTTVLVIEYGVLSDSALISTVQGGFRGMDAQFLYDIQSVPQVNLRNRS
TGVMAGKVVGGSSAVNAMMAVRGAAEDYDRWGSFFDGSNAGGRGGWSAELLKSYFHKALT
FVPPLPDVAKAAGIAYDTAYWGNTSSVYVGWPSFQFPGTTVQFDAFRSMPGVDFPADSGA
GHPGVYWFPSFMDPHKVARSYARTGHHDRAVVRSNYHLLTRTKVDHIMLETNPDRPLNDA
KATGVRFIVNATTATGSASGRNAPVRERPTQFVKARREVILAAGGIHSPQILQLSGIGPK
PLLDAANITTIVDLPGVGQNFQDHPMLTASFSLSNYSSVQPSAADLFLNATFRAWSDAEW
KANRTGPQSLGVGNAAAWLPFPVISERWADVAANLSSQDHAAYLPPNTHATVAQGYKKQM
DAYALALKNNRTAFYNNVLSGGPSSGVLVMLHPLSRGTVNIDPVDPYNREPVVDYRALSN
PLDVAIMADMIRYTRRFFMENAALAQYRPVEIAPGDYVSSEEDLATYLSETVSPTEYHPA
GTCAMLPQSLGGVVDEYLKVYGVPNLRVIDASIIPTLPGANTCQTVYAVAELTSLPCLSA
SGRCLKGGPPLVLLAEHDNGLERRGRAELGVGTAFEQSLNHGILGLEDGAGQRALALVVE
AVRVGAVAEKQTHEIGVAVVGGEHEQTVALFVGQVGGQTGGQGLLEEGEVAGTGAVVEAG
GECNGFIWKALWWWMLWMLWMLWLLLLFLLLLLFLLLLPRLRLLFCVGHCGAWASVCAYK
ARSVLTM

Enzyme Prediction     

No EC number prediction in SPBR_01312-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	49	651	1.6e-154	0.9806338028169014

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.98e-82	49	651	5	525	choline dehydrogenase; Validated
225186	BetA	2.49e-80	43	651	1	527	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.62e-34	513	651	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.52e-26	118	385	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.76e-12	48	386	54	329	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO63808.1|AA3_2	2.50e-264	44	651	34	628
VBB80399.1|AA3_2	7.50e-261	44	651	33	621
CDP28753.1|AA3_2	6.54e-257	44	651	33	618
QBZ55222.1|AA3_2	8.16e-214	43	651	35	645
UQC73730.1|AA3_2	3.37e-190	40	651	36	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	5.27e-102	45	651	1	576	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	4.05e-90	10	651	4	632	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	4.93e-56	49	651	1	555	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.29e-55	48	651	1	556	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	6.77e-51	42	654	31	594	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.35e-81	47	651	35	607	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.04e-75	50	654	47	612	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.04e-75	50	654	47	612	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	2.08e-62	47	651	37	623	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P0DO29|ERIK_HERER	6.03e-52	47	651	31	589	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998490	0.001515

TMHMM  Annotations     

Start	End
796	818