CAZyme Information: SPBR_01184-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_01184-t41_1-p1
• CAZy Family: AA8
• CAZyme Description: ankyrin repeat-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1490		165504.17	6.2104

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000007:284580-290346(-)

Full Sequence      

MPERLKKPRKGFKTLFSRERHNAGGPSNPDFTNIGPAHAAHAPQGLELVSPSSSTLRVAQ
APLVDNSSPPNHGQAQMSVALAATPASPVIPTPPPLNPSDMTNTGTEAQTNADDIEPWTA
AFHLFQEKSPDLAASYEKCLVSLLGMTADDVKLAVPRSVETVVQTQLKRREGKQWKLPLP
LGKTINVRKQTEKLVKLLLYFDPIVKDAVSAQPYAALAWSSVSMLLSLLTNTTIQNEAML
DGFNSINDILVYWNAGEEILRKGNTGAHFLKSLSNLYASIIEYQASVICHISSGQGSRAL
KSVVGAVDWAKKAQKIAQLNTACKDLVDISCRADIQRANDSTLQGMRDIVVALEQSEQQT
HGRERDEKEAELLRNLQCPYDSYKDFNRQRVHGTCEWFFNDDRFHAWRDASTSSLLWVSA
GPGCGKSVLSRAIVDDLRASTAGGSSTVCHFFFKHGDEDRTLAANALSAILHGLFTEDAS
QRLIQHALPSHKSHGKRLAQDFLELWKILTSCAQSDDAGEIICVLDALDECEQQSRHELL
DRLRQFYRDQQPTSAKASKLKFVITSRPYDDLEKQFAGFATANCIQFHGDDKSAEISREI
DFVIDELVDEVAGSFSRDDKKRLKTHLKGMTNRTYLWLHLTFDIIRQSPCEFGRPCDIDE
LLSILPSQVADAYENILNRSKNKKRTETILSIVLAAERPLTLREANVAVAMAFALQNNKS
PPPSTSAELDKQLWPEKTFKSVVTNLCGLFLSVYDEKLVFIHQTAREFLVGARGEGNVWQ
GRFALPTSHSVMSSICVRYLLLQEIHVSYREYFDRITRRRFLDYAAKHWHRHLAAQDPTA
RFDLLSEARILLDGTDIRNQAWMYQSSKVEVLYGMTSLTVASLFCLTSVVEDMLKTGKVD
INKCDAHGNTALHHAAKEGHTAIVWLLLDKGADIYVRNRFDDTAFRDAADNGHTETVKLL
LDNGADINVRSIHGYTALHVAAIRDDSEIVQLLLKEGADVNARDSDRWTPLHRAAEGRSN
KIFRLLLDNGADIHVRSKDGETPLWYAAYFGNSEMVRLLLEKGANVDVLNRWGESILHYT
ADNHAAENGHTEALGLLLAKGADIHVQNAKGNTALHISAKYGYTEAVRLFLDHGANIDAQ
NRDGQTALYKALQENHMSVIRLLLEYGADVFVQDVDGRTALEATHESDPAKATEILSIAL
ELLGKRVDDFPKQDLDGLKELAARVESSLATAHRLYEKWSGIAIELTVIASPLPLQDNEG
ILTWQDENMQLAHGGLANYTVGDPPVWYRGYDPDENAAEQDGQPWMVQRKWASIDPIFTA
ADPFLACNKPGTPGPAYIPVAAGQNLTAVYWYWLHPVGPMSAWLAACPPLDEGGCVGVDV
NALRWFKIWEAGLLAGTGNLAEGIWYQKQFQHWDGSPDLWPVTIPASLQAGLYVVRHEIV
SIHIANRPQFYPECAHLNITGGGTELPPTSFYKTFPGAYSVDDYLSTYIV

Enzyme Prediction     

No EC number prediction in SPBR_01184-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA9	1271	1484	8.9e-42	0.9045454545454545

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410622	LPMO_AA9	2.78e-57	1273	1483	1	193	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.
397484	Glyco_hydro_61	4.85e-54	1274	1483	1	197	Glycosyl hydrolase family 61. Although weak endoglucanase activity has been demonstrated in several members of this family, they lack the clustered conserved catalytic acidic amino acids present in most glycoside hydrolases. Many members of this family lack measurable cellulase activity on their own, but enhance the activity of other cellulolytic enzymes. They are therefore unlikely to be true glycoside hydrolases. The subsrate-binding surface of this family is a flat Ig-like fold.
222980	PHA03095	3.30e-38	923	1181	29	294	ankyrin-like protein; Provisional
222980	PHA03095	1.95e-36	889	1165	29	311	ankyrin-like protein; Provisional
222984	PHA03100	7.15e-36	957	1170	51	251	ankyrin repeat protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68577.1|AA9	1.91e-99	1272	1483	18	222
AEO59823.1|AA9	2.39e-96	1271	1483	17	226
CAP65971.1|AA9	1.32e-83	1272	1482	22	230
CDP30166.1|AA9	1.32e-83	1272	1482	22	230
QRD02825.1|AA9	2.14e-75	1272	1482	18	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NNS_A	5.04e-41	1273	1483	1	199	Crystal structure of HiLPMO9B [Heterobasidion irregulare TC 32-1],5NNS_B Crystal structure of HiLPMO9B [Heterobasidion irregulare TC 32-1]
5UFV_A	7.72e-31	1274	1477	2	195	Crystal Structure of a Cellulose-active Polysaccharide Monooxygenase from M. thermophila (MtPMO3*) [Thermothelomyces thermophilus ATCC 42464],5UFV_B Crystal Structure of a Cellulose-active Polysaccharide Monooxygenase from M. thermophila (MtPMO3*) [Thermothelomyces thermophilus ATCC 42464],5UFV_C Crystal Structure of a Cellulose-active Polysaccharide Monooxygenase from M. thermophila (MtPMO3*) [Thermothelomyces thermophilus ATCC 42464],5UFV_D Crystal Structure of a Cellulose-active Polysaccharide Monooxygenase from M. thermophila (MtPMO3*) [Thermothelomyces thermophilus ATCC 42464],5UFV_E Crystal Structure of a Cellulose-active Polysaccharide Monooxygenase from M. thermophila (MtPMO3*) [Thermothelomyces thermophilus ATCC 42464],5UFV_F Crystal Structure of a Cellulose-active Polysaccharide Monooxygenase from M. thermophila (MtPMO3*) [Thermothelomyces thermophilus ATCC 42464]
2VTC_A	7.05e-23	1271	1477	18	227	Chain A, Cel61b [Trichoderma reesei],2VTC_B Chain B, Cel61b [Trichoderma reesei]
7NTL_A	4.33e-22	1288	1473	14	195	Chain A, LPMO9F [Malbranchea cinnamomea]
4EIS_A	1.82e-20	1274	1488	2	207	Structural basis for substrate targeting and catalysis by fungal polysaccharide monooxygenases (PMO-3) [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00023|CEL1_AGABI	1.04e-41	1272	1483	29	228	Cellulose-growth-specific protein OS=Agaricus bisporus OX=5341 GN=cel1 PE=3 SV=1
sp|G2Q9T3|CEL61_MYCTT	1.39e-26	1272	1477	19	223	Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Cel61a PE=1 SV=1
sp|Q00808|HETE1_PODAS	5.29e-25	397	775	277	628	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina OX=2587412 GN=HET-E1 PE=4 SV=1
sp|Q7Z9M7|GUN7_HYPJQ	3.63e-22	1271	1477	18	227	Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cel61b PE=1 SV=3
sp|O14405|GUN4_HYPJE	1.25e-17	1271	1467	20	211	Endoglucanase-4 OS=Hypocrea jecorina OX=51453 GN=cel61a PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPBR_01184-t41_1-p1.