CAZyme Information: SPBR_00706-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_00706-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase, family 16

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	AWTV01000008|CGC11	42576.27	4.1883

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000008:1499453-1500687(-)

Full Sequence      

MALRRRFAFPSFSGSAWSISAVVGAILLFGFARPAAADCECGYSTVIDGDVQAFTDLIET
DFAHLDNISTNTDWVRQAFNVTSEKDRGSYGEMYAIENMRTQPDPNGQVEDGQAKNGQPA
GLDLTVKANIVAGMVPVSEIDTNRTDILYGSFRAGMKLTNVSGTCSAFFWYFNDTQEIDM
EFLSKEYNASNNTYPVNLVLQSREAAEDGFDAQGTPTFLKVNLPFDPTADFHEYRIDFLP
GSVYFYADSELLAEMDSDAVPTHAGHLVLQQWSNGNPLWSAGPPTEDAVTTVSYVKAYFN
SSLPQRQQDWNLRCRDPSAPGAVCTIPDSTATNTTPAGWFFTSQNNMTNNQTVSGQKNSG
RMTTAATVLWPVFAIVFAIVGWELNIW

Enzyme Prediction     

No EC number prediction in SPBR_00706-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	112	298	4.5e-89	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.21e-41	102	298	20	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	2.49e-10	149	294	68	205	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	3.54e-08	138	251	23	124	Glycosyl hydrolases family 16.
185685	GH16_XET	6.59e-07	148	249	47	141	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.
178706	PLN03161	2.52e-05	148	249	68	161	Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62950.1|GH16_23	6.89e-134	26	379	35	386
AEO58087.1|GH16_23	1.66e-130	33	367	53	406
VBB86764.1|GH16_23	2.33e-129	35	376	41	390
CDP32289.1|GH16_23	3.30e-129	35	376	41	390
UQC77992.1|GH16_23	1.57e-126	37	360	21	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O5S_A	1.01e-06	149	273	96	209	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1GBG_A	1.45e-06	149	273	72	185	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P04957|GUB_BACSU	5.36e-06	149	273	100	213	Beta-glucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=bglS PE=1 SV=2
sp|P07980|GUB_BACAM	9.42e-06	149	273	97	210	Beta-glucanase OS=Bacillus amyloliquefaciens OX=1390 GN=bglA PE=3 SV=1
sp|P27051|GUB_BACLI	9.73e-06	149	273	101	214	Beta-glucanase OS=Bacillus licheniformis OX=1402 GN=bg1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.020641	0.979308	CS pos: 37-38. Pr: 0.9140

TMHMM  Annotations     

Start	End
7	29
364	386