CAZyme Information: SPBR_00512-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_00512-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: galacturan 1,4-alpha-galacturonidase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	AWTV01000008|CGC25	37896.31	6.5688

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000008:1854836-1856422(-)

Full Sequence      

MASGLHPFAMLQPRSPAADGRVCVVTPIRQQAETTGFGADVVDDVPQILQAFADCDGGGT
VVFPKGARYTIASRLNPVVKDVTVHWHGVWEFSTNLTYWRANGYPIAFQNHQAGFVLSGE
RISINGHGTGGIDGGGDSWYAAEQGVTQAGRPMPFVLWNVSDVVVRRFSVVQSPLWSINV
MNGSNLWFDDIYVNNTATTAPPGKNWVQNTDGFDTMDAHNLTIHGGNGVAIGSLGQYPEE
DSSVANVVVRDVRLIARNSDMHNSAYIKTWVGETVFQPRGSYESAGKPNGGGRGSVTNVV
FANFHLDGAGSGPAIDQDSGNNGRDMDRRKRARLCSLLHHGLLSILTYPGLI

Enzyme Prediction     

No EC number prediction in SPBR_00512-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	55	320	7.3e-29	0.7538461538461538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	9.41e-13	81	323	25	254	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	1.93e-04	50	318	85	354	polygalacturonase ADPG
215120	PLN02188	7.81e-04	212	317	235	318	polygalacturonase/glycoside hydrolase family protein
227721	Pgu1	0.001	37	322	88	411	Polygalacturonase [Carbohydrate transport and metabolism].
215426	PLN02793	0.004	226	317	271	338	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ55904.1|GH28	1.70e-127	13	323	30	355
CCD52714.1|GH28	2.40e-127	13	323	30	355
QSZ30223.1|GH28	1.74e-124	43	323	48	353
BCR97806.1|GH28	4.61e-124	43	323	40	345
BCS10262.1|GH28	4.61e-124	43	323	40	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	5.82e-15	35	307	22	292	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAY7|RGXC_ASPNC	1.64e-124	43	323	40	345	Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxC PE=2 SV=1
sp|A1D415|RGXC_NEOFI	2.43e-108	43	323	42	345	Putative galacturan 1,4-alpha-galacturonidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rgxC PE=3 SV=1
sp|A2QBB4|RGXA_ASPNC	2.02e-41	19	306	28	333	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|Q2EQQ2|RGXA_ASPNG	2.02e-41	19	306	28	333	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|Q2UP32|RGXA_ASPOR	1.46e-39	8	306	14	337	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000003

TMHMM  Annotations     

There is no transmembrane helices in SPBR_00512-t41_1-p1.