CAZyme Information: SPBR_00480-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_00480-t41_1-p1
• CAZy Family: AA2
• CAZyme Description: glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555		64369.60	6.3538

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000008:123282-124949(+)

Full Sequence      

MSQHSSRSSSITEKMTPPGSPRTPASAFAATTAKAMTFMPSIPDWIPESVRQKLQYAQLV
YVQTYNKASPIVAHYYMDVSKNMPVGIPARLRRLANVYAVVVCVLLLFVHLSMSSGSAAA
HRAATSVGTVHSDFPHKIWQTWKVNPLEFEEREHNTAYSWLARNPDYQYEVLTDGNEYAY
VEFHFGPEGFNRPDIVDFYRNVRATIVRADLLRYMIMYADGGVYADIDVEALKPMSKFIP
ERYNKRDIDMVIGVEIDEPDWKDHPILGQKSRSFCQWTFMSKPQNPIMMRLIEQIMAWLH
GVADKQKVSISEVVLDFDEIITGTGPSAFTNAILDHINRGRSGKNLITWDYFHDMSESKL
IGGVLALTVEAFAAGQGHSDSGNHDARAALVRHHYHASNWPSRHPRYRHPVYGEVEKCNW
VDDCVKQWDADVADFKKLSEKEQRERIEQHEREVKEQEAKDEEDRKQRQREEEEERERRE
QEEEDERRRKEEQQRKEEEDRRKKNNENKGSERKEGDNNENKDNKSKDNSNNKNNNDNNN
NNNDSNKEKEGDKRN

Enzyme Prediction     

No EC number prediction in SPBR_00480-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	152	241	1e-17	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.70e-22	131	299	79	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.56e-11	151	241	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66402.1|GT32	6.83e-184	87	449	25	392
AEO60901.1|GT32	1.32e-178	87	449	25	391
VBB84288.1|GT32	2.72e-176	130	451	93	415
CDP31064.1|GT32	1.44e-174	130	451	243	565
CAP71672.1|GT32	1.44e-174	130	451	243	565

PDB Hits     

SPBR_00480-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	5.10e-36	131	400	139	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	5.92e-28	134	373	99	349	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.29e-27	131	372	127	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.22e-20	135	338	97	357	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.34e-06	135	229	58	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000001

TMHMM  Annotations     

Start	End
94	113