CAZyme Information: SPBR_00369-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_00369-t41_1-p1
• CAZy Family: GT90
• CAZyme Description: peptidoglycan-binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643		67149.32	10.7517

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000008:992808-994739(+)

Full Sequence      

MFSSSGVNTPDGEAAAARPRNRRPNAAVATGGASSSSSAASMTGGLLSPLSASRSHTNLH
SGSSGSTFGGLQASSSAASAWVPNWSSIQEFATTLLAGSGSSTSGGGSIPRSRSTGARSP
QGRGNVSTRKLPSAWGPAPPDKSSSPSRPSIQDVAAGQTAAREAELKARMTASVLESHPG
VNGGLDVRGKFKKRNSDENLRGSAAAAEVEDCLVYIHRVQATDTYFGIILRYRCNEDAFR
KANGLWSRDNIQIRKWVALPVDACEIKGRPCDDPSLFPQGVDLMASTPTPRNVPPPASQV
NGVSDGDYFGSPAAGSSKTSVTGKSVADDVVSEPPWTHVRWVRLDSSPNPVEIVRMSRTT
FGYFPPRRKKSIRGSVSSVSTPRASLDISLSNASLPERPLADSPNRSSRRPSLLGNRVAP
GTSPISSSPSRHGLGRTSSNQPAVDPRPEWMRRPGGVGSMSRSVRAPGPARDSLNKWTTK
HLPGLNIETLPSMSVMGSETAHFGFGDDQRASIVESSFEDGRDASTAAALKDNGLDKAAA
SIETWLRGAFAKRPGTPGSAAGTPSTSFAGRIGRQLEETLGDLIELEDGPREDGGPGRTA
ATSSSGQTLRPNVSTGWRTESEGSIRGRSAVAAAGRAKGKKDD

Enzyme Prediction     

No EC number prediction in SPBR_00369-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	3.47e-04	216	253	2	39	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	0.005	216	253	1	38	Lysin motif.
396179	LysM	0.007	217	253	1	36	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC89347.1|CBM50	2.02e-151	81	643	94	637
QBZ56316.1|CBM50	1.90e-139	81	628	107	645
QPC76417.1|CBM50	4.55e-138	45	643	77	627
VBB83868.1|CBM50	3.59e-137	81	597	94	588
QPC67531.1|CBM50	5.07e-137	45	643	77	627

PDB Hits     

SPBR_00369-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CY38|Y2072_EMENI	4.06e-44	84	602	120	580	Uncharacterized protein AN12072 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN12072 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SPBR_00369-t41_1-p1.