CAZyme Information: SPBC2G2.17c.1-p1

Basic Information

• Species: Schizosaccharomyces pombe
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
• CAZyme ID: SPBC2G2.17c.1-p1
• CAZy Family: GT34
• CAZyme Description: beta-glucosidase Psu2 (predicted)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	Spom972h_chrII|CGC2	34349.54	4.7002

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Spombe972h	6995	284812	1857	5138

• Gene Location: location=Spom972h_chrII:3466570-3467529(-)

Full Sequence      

MLFNNFLCFAVSAIPLVSAMPLGNAPYHHHHHAGLNASNITVGVNVTNTTAFSKRDGGFP
DGVYDCSSFPDDQNGVVRLDYLGFGGWSGVQKNDGKYGTASTCQDNTYCSYACKPGMSKT
QWPSEQPDNGVSVGGLYCKNGKLYLTQKDNSNLCEDGKGTAYVKNTLSSNVAICRTDYPG
TENMNIPTNIDGGSKQPLSDVDEDSYYNWGGKKTSAQYYVNKSGRSAEDVCVWGNEGDDY
GNWAPMNFGSGYTDGKTWLSMSFNPLSSAKLDYNIRIKSDGGSLSGDCYYEDGSFHGSTA
DSSGCTVSVTGGNAYFELY

Enzyme Prediction     

No EC number prediction in SPBC2G2.17c.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	45	319	1.6e-111	0.900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	5.86e-133	61	306	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA17897.1|GH132	5.37e-247	1	319	1	319
EEB07556.2|GH132	6.82e-156	4	319	70	399
QOU19390.1|GH132	2.95e-107	50	319	154	418
CAY80669.2|GH132	6.89e-107	50	319	72	337
AJR57453.1|GH132	6.89e-107	50	319	72	337

PDB Hits     

SPBC2G2.17c.1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43015|YBOH_SCHPO	9.53e-248	1	319	1	319	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|P46955|NCA3_YEAST	1.22e-107	50	319	72	337	Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCA3 PE=3 SV=1
sp|Q9UR09|PSU1_SCHPO	1.82e-105	57	319	160	417	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1
sp|B3LRC2|UTH1_YEAS1	3.55e-100	57	319	104	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	3.55e-100	57	319	104	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999768	CS pos: 19-20. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in SPBC2G2.17c.1-p1.