CAZyme Information: SPBC2D10.05.1-p1

Basic Information

• Species: Schizosaccharomyces pombe
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
• CAZyme ID: SPBC2D10.05.1-p1
• CAZy Family: GT33
• CAZyme Description: cell wall glucan 1,3-beta-glucosidase Exg3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464		53702.05	6.0746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Spombe972h	6995	284812	1857	5138

• Gene Location: location=Spom972h_chrII:2974828-2976272(+)

Full Sequence      

MGLNKQDLYIYRKQYGVNLGAWFCAERWINDFLFTGEGSSELEAVSGNVKAHGIDKAREN
FEAHWKSWIGIEDFSYMKQHLVNSVRIPLGYWSLGNDELVKGTPFEPYAEVYRNSLHILC
EKIQEAGSLSIGVLLDFHGVYGGGNCDGHSGTSSGKAEFYEKQEYQDRTVEAVKFLSSKI
GQFENVIGIQVINEPIWGQYDVLANFYQKARSVVPSYLPVYIGDGWDKDHWVNWVNDHES
EGFYVVDHHSYFCFGGELCHAPPKLITRRLDTGEEYGKTKLSNIVIGEWSCTLSQESWSQ
TKLHDKRRRDFGEAQLNQYLNYCGGCFFWTYKFLHGKGGDWDFRSVVEDKVINYPPPPPT
ENKAMPALLEQSRDQNFGGHCYYWDQKQHDHPYEHDLYVKGWNQAWEDYIEFLQHGAMIG
FPRAWTQKRMTSISSASAWEYRDGMNAAWLHLERMGFLNPFRHP

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	62	334	2.3e-78	0.9858657243816255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	6.21e-83	1	439	4	407	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_596224.1|GH5|3.2.1.75	0.0	1	464	1	464
CAA21163.1|GH5|3.2.1.75	0.0	1	464	1	464
CAG89835.2|GH5_49	7.81e-91	4	447	28	494
QWU86148.1|GH5_49	8.26e-91	4	444	32	494
QEL59437.1|GH5_49	5.56e-88	5	448	33	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	4.83e-22	16	355	11	381	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	6.53e-22	16	355	11	381	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	6.94e-22	16	355	17	387	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	1.26e-21	16	355	16	386	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PBO_A	1.71e-21	16	355	17	387	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74799|EXG3_SCHPO	0.0	1	464	1	464	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|P38081|YBQ6_YEAST	1.55e-54	3	444	35	490	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|Q8NKF9|EXG_CANOL	1.27e-26	16	355	39	413	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|Q12626|EXG_PICAN	6.64e-26	9	294	44	329	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	1.33e-25	16	363	44	409	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SPBC2D10.05.1-p1.