CAZyme Information: SPBC1734.04.1-p1

Basic Information

• Species: Schizosaccharomyces pombe
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
• CAZyme ID: SPBC1734.04.1-p1
• CAZy Family: GT22
• CAZyme Description: mannan polymerase I complex subunit Anp1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		48990.95	4.8160

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Spombe972h	6995	284812	1857	5138

• Gene Location: location=Spom972h_chrII:1067092-1068384(+)

Full Sequence      

MKANRDFGRDGGPFSITPNRFQPKSSGNPIFRQKTIRTVGIIALTLVLFLFFHRSFFSSF
GEFPSFSSTANAPNSDVQEYDLRKVMNAKFTGDYSPKEKVLICAPLRNAAEHLNMFFGHM
NNLTYPHELIDLAFLISDTDDNTLEVLKQHLDAIQNDEDESKHFNNVLIMLKDFGAIFGQ
EFSDRHGFAAQGPRRKLMARARNWLLSAAIQPYHSWVYWRDVDVETAPNTILEDLMRHDK
DIIVPNVYRPLPDWLGNEQPYDLNSWAESETALQLADTLGEDDVIVEGYAEYATWRPHLA
YLRDPNGDPSVEMPLDGIGGVSIMSKAKVHLEGCEFPAFSFEKHAETEGFGKMAKRMGFS
VYGLPHYVIWHIYEPSDDDKRIMAEMERERKEREAAELEEAKKYQTAGFTQPDDQGAEEG
PLAHADDHVD

Enzyme Prediction     

No EC number prediction in SPBC1734.04.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	75	340	4.4e-120	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	3.05e-157	77	340	2	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_595421.2|GT62	0.0	1	430	1	430
CAA21290.2|GT62	0.0	1	430	1	430
QPC71645.1|GT62	3.57e-169	11	405	17	412
CEF79254.1|GT62	3.57e-169	11	405	17	412
CZS82536.1|GT62	3.57e-169	11	405	17	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	4.84e-67	77	374	6	302	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	0.0	1	430	1	430	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	2.81e-157	31	419	10	404	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	1.10e-125	74	391	169	531	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.97e-122	100	391	97	438	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	1.74e-71	28	374	10	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000013

TMHMM  Annotations     

Start	End
38	57