CAZyme Information: SPAC2F3.01.1-p1

Basic Information

• Species: Schizosaccharomyces pombe
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
• CAZyme ID: SPAC2F3.01.1-p1
• CAZy Family: GH31
• CAZyme Description: mannosyltransferase Imt1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		37130.08	9.4150

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Spombe972h	6995	284812	1857	5138

• Gene Location: location=Spom972h_chrI:3922354-3923313(+)

Full Sequence      

MGRKCRKLLLKGIPICGVILLILWGYSLYNTLRFMVPGKATEPFTLSLSDVSDDTSAPGE
MEKIPRVIHQLWKDENIPERWSNTVNSCRRQHPDENGWQFILWTDEKIMSFMNENYSWFM
PVFHSYPYNIQKFDAARYFILYHYGGVYMDLDIGCKKPMDPLLSKATFILPSTEPIGYSN
DWFAATPKHPFLYQAIHNLSKFNHRYFTKYPTVFLSAGPLFLSYQFCKYLLTPHEPVRVL
PALLYGNGPNSFFSHVTGDSWHGTDAKVFIWIDRNSKSVLFFAFLAAFAILFLCLRVVFK
RRRKRGIAASHSQIQELYP

Enzyme Prediction     

No EC number prediction in SPAC2F3.01.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	79	164	1.8e-26	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.02e-42	25	271	50	290	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.80e-32	78	168	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB53412.2|GT32	7.62e-247	1	319	1	319
CDI52367.1|GT32	5.35e-70	62	281	96	331
CDR87151.1|GT32	1.63e-68	62	281	124	359
CBQ71693.1|GT32	5.31e-68	62	281	126	361
SJX61564.1|GT32	5.31e-68	62	281	126	361

PDB Hits     

SPAC2F3.01.1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	1.35e-247	1	319	1	319	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	6.59e-59	28	293	50	313	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	3.77e-57	10	292	5	282	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.11e-54	46	292	39	285	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	1.94e-51	10	292	5	290	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

Start	End
7	29
279	299