CAZyme Information: SPAC26H5.08c.1-p1

Basic Information

• Species: Schizosaccharomyces pombe
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
• CAZyme ID: SPAC26H5.08c.1-p1
• CAZy Family: GH31
• CAZyme Description: glucan beta-glucosidase Bgl2 (predicted)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		35412.45	3.9877

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Spombe972h	6995	284812	1857	5138

• Gene Location: location=Spom972h_chrI:4134622-4135587(-)

Full Sequence      

MQFLSSFVFAALALLPLSAMAVDEAASEIASSTKPASTNGTLSFCLGVKHADGTCKYTDD
YLADFEVLAPYTNMIRTYATSDCNTLEYLLPALAQSPYNFSAILGVWPTDDAHYDLEKQA
LMQYLPQYGVDHVRAITVGSEVLYRNDLPADVLAERIYDVRGLVQQKLGFDVPVGTADSW
NLWAGGSGDVVITASDFIMSNDFPYWQGQNTSNMTNTFISDTLAALERVQSVKGTNNVTF
WVGETGWPTDGPSYGEADATVDIASEFFQEALCNIRRKGIDIFFFEAFDEDWKGDSSSVE
PYFGAMYSNRTLKYNLNCTSE

Enzyme Prediction     

EC	3.2.1.39:6	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	43	318	5.7e-39	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.07e-142	1	310	5	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.91e-51	42	318	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_594455.1|GH17	6.22e-238	1	321	1	321
CAY05241.1|GH17	6.22e-238	1	321	1	321
CAB16200.1|GH17	6.22e-238	1	321	1	321
BAA19145.1|GH17	2.78e-225	20	321	1	302
CCE93398.1|GH17	2.89e-97	40	318	21	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.86e-40	52	313	46	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.17e-39	52	313	46	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13990|BGL2_SCHPO	1.10e-238	1	321	1	321	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P15703|BGL2_YEAST	8.57e-90	25	318	10	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|P43070|BGL2_CANAX	9.95e-85	40	318	20	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	1.13e-83	40	318	20	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|D4B2W4|BGL2_ARTBC	1.36e-55	26	318	6	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000189	0.999783	CS pos: 21-22. Pr: 0.9567

TMHMM  Annotations     

There is no transmembrane helices in SPAC26H5.08c.1-p1.