CAZyme Information: SPAC19B12.02c.1-p1

Basic Information

• Species: Schizosaccharomyces pombe
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
• CAZyme ID: SPAC19B12.02c.1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: cell wall 1,3-beta-glucanosyltransferase Gas1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	Spom972h_chrI|CGC22	58115.60	3.7999

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Spombe972h	6995	284812	1857	5138

• Gene Location: location=Spom972h_chrI:4878825-4880453(-)

Full Sequence      

MKFSILSLAVAGLVGLAKASVSPVHVDGRYFFYENGTRFFLKGIAYQPNVDDSDTEGTLF
VDPLSDGDACSRDVPYFQELSVNAIRVYAVNASLDHSACMQAFQDAGIYVLSDLAQPYEA
ISSSDPTWTVDLFSRYTEVVDSLAPYDNMLGFIAGNEVIQNNTNTNAAAFVKAAVRDVKS
YIKSSGYRQIPVGYSTNDEEVTRDPMAYYFDCGDDDDHVDFYGINIYEWCGDSDFVSSGY
QERTEEFSNMTVPMIFSEFGCIEVRPRTFSEIVALFSDNMTDVWSGGIAYQYFESENEYG
VVTVSGDSVSTLTDFPYLSSRYASVIPSASYESTMSATLTATMSCQATNSAWMAATSLPP
TPSEAVCECMDSTRSCVINDDVSSDDYSDLFSYVCNEISCDGITANGTYPGQYGSYSYCD
AKQQLDYVLDAYYSAKGDCDFSGSATLVSASSATGTCASYLSAAGSSATNAISLTADSNA
VSRNSSASTMSTSYTSGSGSSNSSGSSSNSSSKSSSGASSYNLNMVITFLSVVIGGTAVL
FI

Enzyme Prediction     

EC	2.4.1.-:30	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	18	324	1.5e-129	0.9903846153846154
CBM43	375	457	4.5e-19	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	3.33e-145	13	325	1	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	3.64e-19	374	446	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	4.14e-12	375	459	2	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_594765.1|CBM43|GH72|2.4.1.-	0.0	1	542	1	542
CAC00550.1|CBM43|GH72|2.4.1.-	0.0	1	542	1	542
CAR21776.1|CBM43|GH72	3.03e-182	5	469	6	473
CCE93403.1|CBM43|GH72	5.78e-178	26	470	30	475
CCH60498.1|CBM43|GH72	1.38e-176	4	479	5	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.15e-115	12	433	24	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	3.22e-115	12	433	24	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	3.22e-115	12	433	24	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P378|GAS1_SCHPO	0.0	1	542	1	542	1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas1 PE=1 SV=1
sp|P22146|GAS1_YEAST	5.19e-171	6	477	9	482	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2
sp|P56092|EPD1_CANMA	3.60e-166	8	465	11	469	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|O13318|PHR2_CANAL	1.23e-165	8	473	11	477	pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR2 PE=2 SV=2
sp|O74137|EPD2_CANMA	6.05e-154	4	457	7	474	Protein EPD2 OS=Candida maltosa OX=5479 GN=EPD2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000253	0.999720	CS pos: 19-20. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in SPAC19B12.02c.1-p1.