CAZyme Information: SPAC12B10.16c.1-p1

Basic Information

• Species: Schizosaccharomyces pombe
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
• CAZyme ID: SPAC12B10.16c.1-p1
• CAZy Family: GH13
• CAZyme Description: alpha-mannosidase GH125 family Mug157 (predicted)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		57153.22	5.7721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Spombe972h	6995	284812	1857	5138

• Gene Location: location=Spom972h_chrI:4601527-4603221(-)

Full Sequence      

MKYWQAILFFLFGIAFANNLNIPWKACPNYKTYSGRRHYPATGPLRLPFQRPATSCRTFH
SKSVEQTIEDVKEQLEDEDLARLFENCMPNTLDTTIRWHAADSHNPQTLVITGDIPAEWI
RDSANQLLPYLPLAKSDSPLATLILGAIQTQAEMLIQFPYCNAFQPPKQSFLSGNDNGQS
DRVTPAYDPAVVFECKYELDSLASFLKLSYTYWLYTKDQSIFTVKWLAAVERIIQVLEEQ
SSPSFDEKTGLPKDPVYTFLRNTDSGTETLGLAGRGFPLNANASLIRSAFRPSDDACVLQ
YFIPANAMMVVELSHLNQMLQASGHADIARTALVWANKIQKGIDQHGIVDHPKFGKVYAY
EVDGYGSILFMDDANVPSLLSLPYLGFVERDDPVYVNTRKMILSSEGNPYYLKGKVISGI
GGPHIGLRNVWPMSLIVQALTSDDDDEIMSLLDVLKHSTAGLGLMHESVDVSSFKSFTRP
WFSWANSLFAELILDLLERKPHLLKKNAS

Enzyme Prediction     

No EC number prediction in SPAC12B10.16c.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	77	494	3.1e-167	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226068	COG3538	0.0	55	508	1	434	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
399660	Glyco_hydro_125	0.0	77	494	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
225922	SGA1	0.002	299	507	412	612	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA94706.1|GH125	0.0	1	509	1	509
EGX53450.1|GH125	8.67e-193	23	504	128	627
QSZ28718.1|GH125	1.27e-192	18	504	31	533
APA12840.1|GH125	3.74e-192	25	504	38	534
CCD53821.1|GH125	1.51e-191	25	504	38	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	4.63e-108	51	497	23	449	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	8.36e-104	51	497	43	469	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	3.39e-102	51	497	21	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	9.26e-85	70	500	18	426	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
3QPF_A	1.27e-84	59	498	3	424	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	0.0	1	509	1	509	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999750	CS pos: 17-18. Pr: 0.9834

TMHMM  Annotations     

There is no transmembrane helices in SPAC12B10.16c.1-p1.