CAZyme Information: SOCG_04880-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_04880-t26_1-p1
• CAZy Family: GT66
• CAZyme Description: glucosidase I Gls1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	KE503207|CGC14	92724.60	4.7089

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503207:1066694-1069202(-)

Full Sequence      

MVLNPVFRVTSWLLLGAVFLLWNALLSHANVNSIGNAINDSLLWGPYRPNLYVGIRPKVP
NSLMSGLMWANVDDYARFSKLRHRAEHGDDIGKFGWTSYDVRRGGQQVIEDLLMGIKLVT
EFVKLPHGNWALRIHGTPLPGAPEDLTTALFFYAYVNGEGNLELKATSPKKVFMEGQTPD
LGKFRIHTYNRMGQHPTTSRVEDLESTAMDKDYYAGFQINSKEVWQTSEILLYLLDTKMK
VLSEHGNMNSLDDLPPAYEALLLPNVPGGNGLQFIQKVFKGEFVFDIIFNTAKTQVATEE
LITKAIEENHKDFSSKFQEVFPLKYPYDENPEYQRFAEFAFANLFGNVGFFEGDSIVSKT
PIEPDDEDYEFMQGFESAKEKLSENTAFFDKERHLLTAIPSRSHFPRGFYWDEGFHLLPI
GLWDNDFSLEILKSWFSLVNEEGWVGREQILGSEARSKVPDEFQTQYPDIANPPTLILAL
KAYIEKLKEQGNKKSFNDVGSDYSLEDLDYLRSVSVSNPEMSIQFLRELFPLMLRHYEWF
RKTQHGDFDTWERESFSDEGYRWRGRTYQHCLASGLDDYPRAQPPSVAELHVDLLSWMTS
FTKSLRFVAEFLGESEEAEKLAKNEYAMLRNLDDLHWDDEAQTYCDASVDQYDDPSYICH
KGYVSLLPLMLGLLPADSEKLTITLNMIRDESELWSPYGIRSLSLNDPYFGTDENYWRGP
VWMNMNYLVLSSLYQNYIHVPGPSQGLAKSIYEELRLNVVNTVFNNWKRTGIFWEQYDSV
TGVGQRTKDFTGWTTVIVNIMSEKY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	587	803	8e-31	0.43859649122807015

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	298	803	2	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	8.61e-71	42	256	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.88e-07	524	751	359	566	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	6.38e-05	592	794	578	772	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB11295.1|GH63	0.0	12	805	12	808
NP_594106.1|GH63	0.0	12	805	12	808
QRC96601.1|GH63	4.97e-244	26	802	24	797
QSS68976.1|GH63	2.60e-243	34	801	37	802
QSS50985.1|GH63	5.94e-242	34	801	37	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.55e-167	39	801	12	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	4.38e-115	32	805	27	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	0.0	12	805	12	808	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.52e-166	39	801	42	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.39e-117	32	805	84	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|Q80UM7|MOGS_MOUSE	3.54e-117	32	805	82	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	3.73e-116	32	805	82	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.953340	0.046674

TMHMM  Annotations     

There is no transmembrane helices in SOCG_04880-t26_1-p1.