CAZyme Information: SOCG_04814-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_04814-t26_1-p1
• CAZy Family: GT58
• CAZyme Description: mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		38030.98	5.0224

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503207:928906-930116(+)

Full Sequence      

MKLVLVCLLLSIAIPFVVQRFRSNELPLNNVLSVKRLPQKTSLNASLLLFTEDGDLLDVL
QTIRSVEDRWNKRFHYPWTFFSSEKLSSYFMEATSSVASGNCEYVQWDSTEYFGTGLKDT
MYYLERSEKLSGEGVKYSRSGSFHRYQEWILHSLLYHPQLRFQYVWRLEPGLRFTCEEEL
DYFEEMAKHNATVGFTNHVCETRHSGILELEQSLNKYEQEGMPERPRTAWEYSTEDTYCK
FLPYDEIISLKELRGNSSLVQLTQHLLNEGGIYYHRWTESDILSAVLQVYNTPVLPLDTA
GYIFRPDINHCPDMESGRCACYLED

Enzyme Prediction     

EC	2.4.1.131:20	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	44	290	2.5e-49	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	2.70e-60	21	321	61	369	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	3.53e-27	44	284	44	289	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB93011.1|GT15	1.88e-83	47	321	4	297
NP_594171.1|GT15	1.88e-83	47	321	4	297
QSS53129.1|GT15	2.57e-26	38	319	72	365
QSS76282.1|GT15	6.74e-26	38	319	72	365
QSS58152.1|GT15	6.74e-26	38	319	72	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BOO_A	2.13e-23	44	290	68	327	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	6.20e-23	46	319	106	397	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]
1S4N_A	5.62e-13	55	321	39	314	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P4X2|OMH6_SCHPO	3.34e-84	47	321	4	297	O-glycoside alpha-1,2-mannosyltransferase homolog 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh6 PE=3 SV=1
sp|O74546|OMH3_SCHPO	1.49e-23	38	321	59	355	O-glycoside alpha-1,2-mannosyltransferase homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh3 PE=3 SV=1
sp|O42944|OMH2_SCHPO	2.63e-23	44	325	63	348	O-glycoside alpha-1,2-mannosyltransferase homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh2 PE=3 SV=1
sp|P38131|KTR4_YEAST	3.91e-22	46	319	136	427	Probable mannosyltransferase KTR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR4 PE=1 SV=1
sp|O60160|OMH1_SCHPO	1.94e-21	37	321	65	356	O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.784486	0.215519

TMHMM  Annotations     

There is no transmembrane helices in SOCG_04814-t26_1-p1.