CAZyme Information: SOCG_04268-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_04268-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		42081.13	8.7041

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503208:635209-636288(-)

Full Sequence      

MNKPAVIFFSILSLIIVFTLHLFWGPIKLFFIDYRTDILQASDLPDDFSYSPNHNTTESI
PRVIHQTWKTEDIPGKWKDAQQSCIKLHPNYEYKLWTDEAMREFVKENYPWFLPQYDAYP
FNIERADVVRYFILYHYGGIYLDLDVGCNRSMNPLLEYPAFVRKTSPSGISNNVIGIRKK
HPFLLQVIRSLPSYAFNYHFPYLTVMYSTGPLFFSIIWRAWRSLPMAEAWHHISVLNSDL
YTGSNHSFFNIYEGSSWHDNDAGLVFYLLRHWLLLTILGFMLFFFIVFLFFGSSLKPAAR
VSRSSRRAFGSPFSSKSSSPWRKFKQYVSTDESSDQQNSDAIPFMAEIDLESQTRPKSR

Enzyme Prediction     

No EC number prediction in SOCG_04268-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	156	4.6e-27	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.75e-78	1	303	10	326	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.87e-30	74	161	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA93694.1|GT32	6.92e-168	1	358	1	355
CCD51739.1|GT32	1.29e-91	1	280	1	278
ATZ48182.1|GT32	1.29e-91	1	280	1	278
QSS66595.1|GT32	1.93e-90	1	282	1	280
APA07946.1|GT32	8.34e-90	1	280	1	278

PDB Hits     

SOCG_04268-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.23e-168	1	358	1	355	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.07e-89	60	295	82	319	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	2.32e-79	45	288	47	290	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.10e-78	37	288	37	282	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	5.43e-59	39	262	46	266	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998835	0.001180

TMHMM  Annotations     

Start	End
5	27
196	218
271	293