CAZyme Information: SOCG_02160-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_02160-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: mannosyltransferase complex subunit Alg1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	KE503206|CGC13	48599.75	9.3389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503206:2995163-2996688(+)

Full Sequence      

MLVIRILLFLSLVIFINSRRSAKSKRIIILVLGRIDQSPRMQYHALSFAKEGWEVNLVGY
QDKKASGLFRSHQNIKIHAIPTLPKQFSFRSRLSFLLIAPAKILHQLLSLLFIIFKIKQS
SYFLVQNPPSIPTFFLGHVLFLLRGTRFVIDWHNFGYTILALKLGKNHLFVKILRIYERI
LAKYAYCHITVSHSMQRVLEGWGIRPCHVCYDRPPAHFQPLQASTRTSDLQVIPADFDPR
IEKLLVTSTSWTPDENIYALWDALKMYSETQNAVPLLVLVTGKGPGKADFVKHIEKNPLE
NIRFCLPWFSSEDYPRAIACADFGVSLHQSSSGYDLPMKVVDLFGCGVPVVAWNFPAISE
LVHDNENGFIVDNYVELYKKIEMLCSDERMLQSVRQGALDESKIRWDDEWTKTIPQLFTL
DSS

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	25	415	4.5e-135	0.9905882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	1.04e-179	23	418	2	411	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	1.81e-116	23	384	3	370	transferase, transferring glycosyl groups
340825	GT4_WbuB-like	1.06e-20	40	388	19	363	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
223515	RfaB	6.89e-18	100	417	64	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340831	GT4_PimA-like	2.48e-14	130	417	90	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB16885.2|GT33	3.11e-173	1	417	1	419
NP_593186.1|GT33	3.11e-173	1	417	1	419
AOW29327.1|GT33	1.14e-97	17	418	44	452
AOW06371.1|GT33	1.57e-96	23	420	38	440
CAX42421.1|GT33	1.80e-96	17	418	44	452

PDB Hits     

SOCG_02160-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13933|ALG1_SCHPO	5.53e-174	1	417	1	419	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg1 PE=3 SV=2
sp|Q59Q79|ALG1_CANAL	2.02e-98	17	418	44	452	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG1 PE=3 SV=1
sp|Q6C3K2|ALG1_YARLI	3.94e-97	23	420	38	440	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG1 PE=3 SV=1
sp|Q6FLZ2|ALG1_CANGA	6.00e-96	22	417	38	446	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALG1 PE=3 SV=1
sp|P16661|ALG1_YEAST	1.98e-87	25	417	39	445	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.950601	0.049412

TMHMM  Annotations     

There is no transmembrane helices in SOCG_02160-t26_1-p1.