CAZyme Information: SOCG_01732-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_01732-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
989	KE503208|CGC12	111302.92	6.1815

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503208:2634991-2637960(-)

Full Sequence      

MGRILIANLFLPSTVGFSFDTVPRDAIGSRFLQREESKDWIEDAPLDAPLDENAILSEDD
EDEDDQGDLNSNDNRHYPPYRSDSTPSASTSSSDNDDDDDDNQSATVLSDLPEEVESSSR
PSSLHASTASMPGIRSQAGTPSVHSGTGSPKLDDPLSNLQKLLKKRGRRHLAFNDDEGLS
LPPSRHQSPPPSNVLASYKRRTSNDRDMQSFARRASRSLSFSTGHGGGLHPGRRMTFDAE
AWKKISYRILPNSYGNASFYNAVHAADRTGKFDEHFFIGTSGVPTDSLPDMVKQKISDDY
LTSHKSIVVYPSDTDFVGHYNHYCKNILWPTFHYQIPDNPKSKAYEDHSWANYVKVNQKF
ADSILANYREGDMVWINDYHLLLVPQMVREKIPAANIGFFLHIPFPSSEVSRCLATRQEI
LRGMLGANILGFQIPEFAYHFLQTCSRLINIDIRKDGTVSLDGRKIEIVALPISIDPAAL
DKQLQSNQVQHWIRVLRDRFKGKHIILSHDKLDPICGLRSKLLSFEIFLHRYPQYRENTI
LLQIAPESLQDNLHLPLISDIVTRINSSYSNIASRHVPVILLRQKISIHQFLALMTISDA
LIDNSLREGISLTSHQFIYAQRERHRPLILSEFVGSSSILGHNAIVVNPWDYSNTADAFY
KALSMSPSECEERSKVMCNLILRHDATSWAITFGTLIKESWKEQQANDKSKLTFNADLIL
KPYHNAKKRLLFLYFEGTITSWGSQNQSVTSGLQRTVNLLTDLTADPKNTVYIISALGRQ
ELDQLFQRVPRLGLVAENGCFTRAPPTADALPPSEQQIAALWKSEIKDVDLSWIKTVTEI
FSYYAERAAGSYVEEKDASVALHLREAEDPEFASWAAKECCESVNNFDIPCRATIQNDTV
ICRSSKVSKRLAVEDIYKSNGADFDFIFSASNETDDDSVFRWIAGFKHMGPKPPFTHTVY
VGDHDYGTYADSESSGVFGFLQAFEKVFS

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	269	693	1.8e-137	0.8842105263157894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	233	693	7	458	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	236	693	13	464	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	1.38e-169	276	705	60	486	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
184712	PRK14501	6.91e-146	246	962	20	700	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	2.11e-113	282	937	57	715	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_593962.1|GT20	0.0	1	989	1	943
CAA20146.1|GT20	0.0	1	989	1	943
CBG04460.1|GT20	0.0	1	989	1	943
CBF70323.1|GT20	0.0	1	989	1	943
ABW72067.1|GT20	1.58e-203	149	987	76	900

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	2.65e-85	318	693	146	519	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
6JBI_A	1.93e-81	319	693	84	458	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	4.95e-78	283	695	65	472	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	2.55e-77	283	693	64	470	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	4.74e-77	282	702	51	469	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	0.0	1	989	1	943	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	1.40e-177	224	971	135	877	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38426|TPS3_YEAST	9.85e-142	240	905	307	941	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	1.67e-135	240	871	339	940	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	1.03e-108	292	908	75	665	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.738532	0.261470

TMHMM  Annotations     

There is no transmembrane helices in SOCG_01732-t26_1-p1.