CAZyme Information: SOCG_01278-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_01278-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: beta-glucosidase Psu2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305		32769.92	6.3666

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503208:1634059-1634976(+)

Full Sequence      

MLFSKLLVSAISLVPLASAIPVGNVQGHRHHNQSTIKRDGGGFPDGVYDCSHFPEDQDGV
VKLDYLGFGGWSGVQKNDGKFGTASTCEDNTYCSYACKPGMSKTQWPSNQPSNGESVGGL
YCKNGKLYKTQKNSNNLCENSHGNAYVKNTLGSNVAICRTDYPGTENMNVPTDIGSGSQQ
PLSVVDEDNYYNWGNKKTSAQYYVNKSGKSAQDACVWGNQGDDYGNWAPLNFGSGYTDGK
MWLSMSKNPLNSQANVDYKITIKADGGTLSHDCKYENGSFHGSGASSDGCTVSVTGGGAY
FELYN

Enzyme Prediction     

No EC number prediction in SOCG_01278-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	29	304	1.2e-107	0.900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.16e-124	45	291	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA17897.1|GH132	1.50e-174	1	304	1	319
EEB07556.2|GH132	7.49e-142	2	304	68	399
CAB65613.1|GH132	2.16e-105	41	304	160	417
CAR24044.1|GH132	7.78e-103	43	304	105	361
QGN17016.1|GH132	1.04e-102	43	305	147	403

PDB Hits     

SOCG_01278-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43015|YBOH_SCHPO	2.66e-175	1	304	1	319	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|Q9UR09|PSU1_SCHPO	3.84e-106	41	304	160	417	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1
sp|B3LRC2|UTH1_YEAS1	3.03e-100	41	304	104	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|B5VMJ0|UTH1_YEAS6	3.03e-100	41	304	104	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2
sp|A7A003|UTH1_YEAS7	3.03e-100	41	304	104	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999695	CS pos: 19-20. Pr: 0.9703

TMHMM  Annotations     

There is no transmembrane helices in SOCG_01278-t26_1-p1.