CAZyme Information: SOCG_00931-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_00931-t26_1-p1
• CAZy Family: GH27
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901		101680.05	6.7592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503207:3360634-3363339(+)

Full Sequence      

MGRNLVCSIFLPYTINFHLDELENKGPENLPASYEASRNRRNSVLIDNALSHLAISQKDN
SPGTPVLTPQPENTSDYFGTAAVRRGGNTGSGTGSGIKTPKTSNIGTKTPLPASGRSSPV
YTQPRSRAASPPSFTQPDDRFGAPGIGAKKNLIRKRRDSLIKDVALFESARWTVERGING
NNGLFSAVGAAVRDKKITNQLWVGLLGMPTESLSKKTKDAISAALLVKHQSLAVYTSDSE
FEGHYNHYCRKILWPSLHYQHNEIFSFFHEENNWDAYVSVNQAFADKIIETYRSGDTIWV
NDYHLLLVPGMVRKKLPNAAIGLFVHVSFPSSEVFRCFARRNELLLGMLGANLIGFQTEE
YKRHFLQSCSRVLYAEATFGRILLEDRYIDVYSHPVSADPESVQANLDSEETIETIEVLK
KRYENLNVFVGCDKLDPIRGIREKLLAFEQFLYDNPSYQKNTILLQTSAFTDEARQYGVE
VSDIVTRINSTFGDFSLDHLPVTFLSRDLSYAQYLAVLSIADGFIVTSLREGMSLTCHEF
ILTQQEKKSPLIVSEFIGCSAFFREGALIVNPWSTLEMSHAMRKALEMDDASKKKRYDLC
INVIRNHTASTWAAEFENRLKKSWTSQQRHDLSHIPKFTLNFVGSRYASAKKRLMFLNFD
GQAVSWEGRHEFMDYHYGYIINILTRLVNDPKNVIYICSCLDRDELDSLFVNLPGLGLIA
ENGCYVKPHTAGDDNLQGWIRLFKKDEMTWRDSMHDIIEYYAERNQGSSLIDHGYAMEFN
YVKAENKENGMRNALELCSSVNETGNTCKAIPMEGHVLIEPKNISKATAANYTLNKILHN
PEDLDLVLVAGNNRTDEGTFVWANRLPIFSFTVSMRLENTDAHSYTDGVPSFFNVLNSLC
E

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	172	622	1.4e-138	0.9305263157894736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	173	621	19	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
223457	OtsA	5.40e-166	167	623	29	480	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
395781	Glyco_transf_20	2.87e-163	182	621	31	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	5.09e-142	183	899	29	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	1.14e-107	183	851	40	707	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB52715.1|GT20	0.0	1	900	1	890
NP_594728.1|GT20	0.0	1	900	1	890
CBF70318.1|GT20	0.0	1	900	1	890
CBG04458.1|GT20	0.0	1	900	1	890
EGX50369.1|GT20	2.87e-205	6	899	5	910

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	5.60e-83	173	622	24	476	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	7.68e-82	173	622	16	469	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVO_A	2.12e-81	196	616	50	470	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	2.87e-81	173	622	16	469	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
6JBI_A	2.00e-80	173	622	12	464	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UUI7|TPSY_SCHPO	0.0	1	900	1	890	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|O14081|TPSX_SCHPO	3.03e-183	1	899	1	941	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|P38426|TPS3_YEAST	8.42e-131	135	768	277	885	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	3.55e-122	141	788	314	940	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	2.88e-100	198	897	55	733	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000024

TMHMM  Annotations     

There is no transmembrane helices in SOCG_00931-t26_1-p1.