CAZyme Information: SOCG_00858-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_00858-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		57426.33	6.1136

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503207:3179035-3180685(-)

Full Sequence      

MIAFWSLFLFFSVSLANSFDFAWKSCPNFKDFSTRKHFPLAGSLKLPFQRPVQACRTFHS
KEVEQTIDDVKSRLADEDLARLFENCMPNTLDTTIRWHEDHPDHPQTLVITGDIPAEWIR
DSANQLAPYLPLVKSDRPLSSLILGAIQTQAEMLIQFPYCNAFQPPKQSHIGGNDNGQSD
RVTPAYDPQVVFECKYELDSLAAFLKLSYNYWFYSKDSSIFSPKWVSTVQVIFRVLEEQS
TSTFDPDTGFPKNPVYTFLRQTDSGTETLGLSGRGFPLNKNSSLIRTAFRPSDDTSILQY
LIPANAMMVVELSHLHEMLQVAGHADLAKIAMSWANKISNGIREHGIVDHPKFGKVYAYE
VDGYGSAIFMDDANIPSLLSLPYLGYVERDDPIYLNTRKMVLSPEGNPYYLKGTVIAGIG
GPHIGLRNVWPMSLIVQALTSDDDNEILSLLQTIKRSTNNLGLMHESVDVTSFARYTRSW
FSWANSLYSELIIDLLERKPHLLEKKH

Enzyme Prediction     

No EC number prediction in SOCG_00858-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	76	493	6.5e-163	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226068	COG3538	0.0	54	506	1	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
399660	Glyco_hydro_125	0.0	76	493	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA94706.1|GH125	1.05e-296	7	505	8	506
EGX53450.1|GH125	1.74e-194	25	503	132	627
APA12840.1|GH125	8.03e-191	24	503	38	534
QSZ28718.1|GH125	1.26e-189	24	503	38	533
CCD53821.1|GH125	1.85e-189	24	503	38	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	4.30e-105	50	503	23	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	6.89e-102	50	503	43	477	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	1.11e-99	34	503	6	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.70e-83	61	499	9	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	2.68e-83	61	499	9	426	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.87e-297	7	505	8	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000716	0.999259	CS pos: 18-19. Pr: 0.9329

TMHMM  Annotations     

There is no transmembrane helices in SOCG_00858-t26_1-p1.