CAZyme Information: SOCG_00710-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_00710-t26_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: cell wall protein Gas1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537		57476.71	4.7492

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503207:2848651-2850264(-)

Full Sequence      

MKLSLLSLAAAGLVSLGNLVQASVPPVHVDGRYFWNKNGTRFFIKGIAYQPDSNGDEKYV
DPLADKSTCERDVKYLKELSVNTIRVYSVNSSSNHDDCMKIFDDNGIYVLSDLSSPDVSI
NGKDPSWSVDLFKHYTDVVDSLAPYNNVLGFIAGNEVVQNVNNTDAAAFVKAAVRDVKQY
IVNSGHRQIPVGYSTNDEQETRVPMSHYFDCGDKADIVDFYGINIYEWCGDSSIHSSGYD
ERTKEFQNYTVPVFFSEFGCIQVRPRKFTEVKALFSDEMTDVWSGGVAYEYFQAANKYGV
VSVSGDSVSTLTDFPHLSSMYASVQPSPTQSSSMSLTSSGQSCAATQKAWKAATDLPPTP
SEDVCECMDKTRQCVVADGVDSSDYGDLFSYVCTKIDCDAISANGTAPGKYGSFSYCDSK
QKLNYVLDAYYQQKGGCDFKGSASSVSAASATGACKSYLSAAGSSGTKPISVTPDANAVS
KGNGTDNMSSTYGGGGSNGKNGTTSGHQKSAASTSINTNALVALVSMVVGGVAVLCI

Enzyme Prediction     

EC	2.4.1.-:30	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	21	323	5.7e-132	0.9903846153846154
CBM43	374	456	5.9e-19	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	6.69e-148	22	324	7	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	7.61e-26	374	441	3	73	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	1.26e-14	374	441	3	69	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
225344	BglC	0.002	72	236	78	269	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
225789	LacZ	0.003	38	232	296	474	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_594765.1|CBM43|GH72|2.4.1.-	3.26e-236	1	481	1	483
CAC00550.1|CBM43|GH72|2.4.1.-	3.26e-236	1	481	1	483
CAG86251.2|CBM43|GH72	6.19e-178	2	462	3	470
BAP73894.1|CBM43|GH72	2.97e-176	8	467	6	474
QGN17770.1|CBM43|GH72	2.97e-176	8	467	6	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.62e-126	29	438	39	463	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	4.55e-126	29	438	39	463	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	4.55e-126	29	438	39	463	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P378|GAS1_SCHPO	5.79e-237	1	481	1	483	1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas1 PE=1 SV=1
sp|P43076|PHR1_CANAL	1.58e-168	21	456	23	475	pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR1 PE=2 SV=4
sp|O13318|PHR2_CANAL	7.90e-168	8	473	11	479	pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR2 PE=2 SV=2
sp|P22146|GAS1_YEAST	5.22e-167	4	475	5	482	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2
sp|P56092|EPD1_CANMA	6.06e-166	8	466	11	472	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999730	CS pos: 22-23. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in SOCG_00710-t26_1-p1.