CAZyme Information: SOCG_00667-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_00667-t26_1-p1
• CAZy Family: GH132
• CAZyme Description: O-mannosyltransferase Ogm4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785		89860.60	7.8618

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503207:2741803-2744160(-)

Full Sequence      

MRPTISEKSGKKNQKSSKKNGSTSRPSSPPETSPTHSSALSEKEVSSSKPQTVPSAGPDA
SSNNTFQFKLAQYLIVIVSFLTRFWKLHVPNEVVFDEVHFGKFASYYIQGKYFFDLHPPF
AKLLLAFVAWLAGYDGHYLFDNIGDNYKDYGVPYVAIRAWPALLSSLVPPLVFLTMKESG
YELWACLVSACLVLFDNAHVAEGRLILLDATLVFSMVAAVYCYVRFFKLRHSPFSRGWWS
WLFLTGVCLSCTISTKYVGLFTFCSIGLSVCLELWYLWDIKTGLPIQRFASHFLARFFCL
IVFPFALYLFWFFLHFRLLTTSGPGDSFMSLQFQETLDENPISANATGVNYYDVVTIKHM
GTNAFLHSHLDKYPIPYDDGRISSGGQQVTGYPFEDDNNYWMILPHDHYDDPKYKPNMPV
KNTDYIKLHHVGTNTDLITHDVASPYNPTNEEFTTVSVDESAAEKHELTLFQLVISDEDS
HDRQVFTKAMSFKLIHKLTNVAMWSDPKPLPDWGFNQQEINGAKNILSGPIFWMFDDILG
LPEERVNKEVRVPKKLSFFKKYIELQLVMFRQNNLLTESHPYSSTPSDWFTLHHGIAFWA
KNEENKQIYLLGNPIGWWLIGGIVITTTVVASVEMLLHQRGIVTLLPSVRNHFYRSIMFF
YATYMFHYIPFYLMGRQLFLHHYLPAQVAGAMLCGAFIQLACIKSFKLPVSPGVKQPTDV
DSNGYAKSIRRKGYICHALLSLALTAVLGYCFVFFAPMTYGDVSLSVPEWLRRKWLESWV
FQYQK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	75	316	1.3e-68	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	64	785	19	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.44e-90	74	320	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	4.93e-58	560	777	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	3.89e-12	365	525	11	175	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	2.73e-11	349	406	4	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA16916.1|GT39|2.4.1.109	0.0	67	785	57	776
NP_596807.1|GT39|2.4.1.109	0.0	67	785	57	776
CAK42948.1|GT39	7.50e-252	70	776	44	763
QSS65660.1|GT39	3.58e-251	68	776	47	768
QSS55406.1|GT39	2.04e-250	68	776	47	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	2.35e-94	65	779	46	727	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	7.37e-90	74	779	70	751	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	0.0	67	785	57	776	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	2.44e-210	74	777	58	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	6.49e-203	66	777	45	748	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|Q99PR0|POMT1_RAT	9.23e-106	65	779	34	740	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1
sp|Q8R2R1|POMT1_MOUSE	9.86e-104	81	779	50	740	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000001

TMHMM  Annotations     

Start	End
112	134
154	176
183	200
205	227
234	253
258	280
293	315
615	637
657	674
684	706
734	756