CAZyme Information: SOCG_00532-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_00532-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: pig-V

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	KE503207|CGC4	50257.04	9.5879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503207:2471461-2472771(-)

Full Sequence      

MTEQFPLKEKKSTTNSKNSVNKDECVKSKKSLNKIKHKLFSINSRKTCVLLFFLSTVSYL
GIAFLTSFFSVFDHTANLYLSQNDSQIRNNLLGGFFKAWIRWDAIYFVDMALQNRLFEQE
WAFSDFWSALIRFVCFGSKDVVVLGLAACCLAIVLHAVAAAAFYCTTKVIFLDKQISVLS
IIFYLLSPAGIFMSVGYTESAFAACSFLGLLCFVRKRQTLAMLFWSISTFFRSNGIFWSF
LFVIPTVESLYSFARQEVGFTKFFRTAFINGCRCIEIVIPFFYGQFQAYKVFCPHASWCL
SYLPFIYPAVQKKYWNIGFLSYWTPNNIPNFLLACITIVPLVFSLWYSTSFIRTDATIRY
LFILSLFYLYLGIFQMHTQVINRLSSAFPLLYWSLAHAWSRSSSLHIRKFTEAILFSWVL
YSLIQAGLYGSFLPPA

Enzyme Prediction     

EC	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	51	436	5.1e-87	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227829	COG5542	2.78e-47	47	436	21	407	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].
282094	Mannosyl_trans2	1.56e-35	45	436	1	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA90590.2|GT76	5.09e-135	48	436	73	464
QNQ01203.1|GT76	2.49e-46	95	436	42	357
CAG78103.1|GT76	3.48e-46	95	436	42	357
AOW07008.1|GT76	3.48e-46	95	436	42	357
QYT02819.1|GT76	2.91e-42	101	436	66	437

PDB Hits     

SOCG_00532-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09712|GPI18_SCHPO	9.04e-136	48	436	73	464	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2
sp|Q6C216|GPI18_YARLI	6.18e-47	95	436	42	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.06e-41	101	436	64	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	2.80e-34	100	436	79	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.14e-32	102	436	81	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999961	0.000031

TMHMM  Annotations     

Start	End
49	71
141	163
176	198
235	254
267	289
328	347
360	382
414	433