CAZyme Information: SOCG_00496-t26_1-p1

Basic Information

• Species: Schizosaccharomyces octosporus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
• CAZyme ID: SOCG_00496-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: chitin synthase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866	KE503207|CGC3	98256.89	6.9368

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SoctosporusyFS286	5355	483514	361	4994

• Gene Location: location=KE503207:2373027-2375670(-)

Full Sequence      

MSRWIRRPLPRPADEEEMAGLTTEPPSHGSILTIPTLNYQNSDGSSFQVSETDEDEKEFR
HLVPSSEAHSIDDFIIDDYIRGEEEEDASAPFEGYTAQPNPISSYDRNTASQSAQQQSNH
GSRLRRKKTIQRVELFRGNLVLDCPVPKKLIASLPQQQDREFSYIRYSAATCEPQDFVKN
LFTLRQPLFAQPRKTEICIAITIYNEDEILFARTMHSIMKNISYLCSKRSSPVWGVDAWK
KVVVCIIADGRTKIHPKTLAYLASIGVYQDGIAKNKVNEKEVTSHIYEYTTQLSIDPNLK
FKGSEKGIVPVQMIFCLKEQNKKKINSHRWFFQALCPVLQPTVCILLDAGTRPGDQSIYH
LWKSFDINQRVAGACGEVVVMKGKYGSGLFNPLVAIQNFEYKMSNLLDKPLESIFGFISV
LPGAFSAYRYEALLNDDNGNGPLESYFRGELQDGECSGIFEANMYLAEDRVLCFELVSKH
NQAWTLHYVKSAYADTDVPDRVPEFLLQRRRWLNGSFFAAIHSIVHYYRIFQSTHTFGRK
VLLIVEFLYLFLHMLYSWFNVGNFFIIFYVLTSSVAPKEAKFPPGAVLAKIVNWIYGALL
IPCFILALGNRPHGSKIFYTTMIVLYAMLMCYLLFCSAWISYRGIVHAMEVAKDQDSSVG
YALANNSIFINIVVSLCTTYGMYALVSLISCDPWHMLTSFFQYLLLSPIYTNLLSVYAFC
NTHDVSWGTKGDHTVSNDLGTAKKDHRGSVVEIAIPTNESDIDENYEKAVRLLASPIDET
ILSKDGSIKTQDFFKNFRTVVVLAWIFSNLALVAVVINLNQTSGISITENKTSYYLVFLF
WSILAFSAVRFIGCIVYLFLRIVTGE

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	203	365	1.8e-79	0.9938650306748467
GT2	343	582	4.9e-22	0.43263757115749524

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	2.52e-114	204	365	2	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	3.22e-97	199	519	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	1.22e-31	132	202	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	1.39e-27	314	653	115	409	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.44e-18	199	435	1	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA91105.1|GT2|2.4.1.16	0.0	1	866	1	859
NP_592838.1|GT2|2.4.1.16	0.0	1	866	1	859
CDS05079.1|GT2	1.59e-293	125	865	123	864
BAA19857.1|GT2|2.4.1.16	2.05e-293	125	865	98	841
CDS12882.1|GT2	1.04e-289	125	865	85	826

PDB Hits     

SOCG_00496-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30597|CHS1_SCHPO	0.0	1	866	1	859	Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chs1 PE=3 SV=2
sp|P87073|CHS1_PHYB8	3.63e-294	125	865	98	841	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30594|CHS1_RHIOL	7.92e-290	125	865	113	858	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	2.72e-285	125	865	115	858	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|J9VGT6|CHS8_CRYNH	8.25e-270	124	866	301	1032	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

Start	End
592	609
624	646
667	689
699	721
800	822
837	859
549	571