CAZyme Information: SMR64496.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR64496.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632		68625.71	5.0247

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854285:505818-507716(-)

Full Sequence      

MVVLIPGLRNLTLAILSSIIFLTIYLSRAQLPGRNGRLHEHDAFSSVQAKNDFYGIPKTE
FKPSTMAEESEKYFLQEASLDAKLKATEGMLKAEGAESSTAVKVEDDLGFPTPEFKASGG
LNRMKRYAPHNFHGPGKPTFATYYSVPSTSLKEPNFVSILHLAYRLLWHPPTRSTKYPFT
VFVAPGTSDAQRNVLIAMGCLVRELDPLIPAVAATAVSDMYDLPGDFDLLNLWSQTLFDR
IAYLAPNVFITGPVDEIFDLATTRKCEVDRLGVEDREIHGTGKGLCRFVFAAVMKEIGEE
NEDGERAKEVDTGVMVLSPSLGMRRRLGREVGRYLGVLGPEKKVEMAMGPERARETARQR
AERLLKEVPLKDLPAGPVSEGEKIPPGAAPLMGTKLKPGEAPVAAAPSEVADTKPVPGEA
GLEAAGDSAATAPSAGKQTIPGEGDSTADEAASTDANSKSDEASPPLAGQQTVPGALESE
AAPPPSEARSSKPDIRQHPSSEKSQLTRRALIPWRLTSRDDSPPPPPPSEEPPSEDSPIP
TTPPTLPTFLTTLFGPTSAFPMHVLPREWNGFAPQGDDEGVLKTVNLMYWRDDGGVEWLR
HRFGRVHEEMMEGVEGEGFRKEREGDGGRVYL

Enzyme Prediction     

No EC number prediction in SMR64496.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.35e-10	162	323	19	141	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
411345	gliding_GltJ	9.82e-06	385	510	399	517	adventurous gliding motility protein GltJ. Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.
215090	PLN00176	3.30e-04	175	260	51	135	galactinol synthase
235906	PRK07003	3.58e-04	375	513	366	506	DNA polymerase III subunit gamma/tau.
236090	PRK07764	0.001	373	493	364	484	DNA polymerase III subunits gamma and tau; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR64496.1|GT8	0.0	1	632	1	632
SMY29836.1|GT8	0.0	1	632	1	632
SMR61996.1|GT8	0.0	1	632	1	631
SMQ56160.1|GT8	0.0	1	632	1	632
SMR50089.1|GT8	3.45e-37	103	351	148	380

PDB Hits     

SMR64496.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H1S1|GOLS6_ARATH	2.01e-07	175	259	53	136	Galactinol synthase 6 OS=Arabidopsis thaliana OX=3702 GN=GOLS6 PE=2 SV=1
sp|Q4PSY4|GOLS7_ARATH	2.62e-07	175	291	48	150	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|Q9XGN3|GOLS2_AJURE	2.06e-06	175	260	12	96	Galactinol synthase 2 (Fragment) OS=Ajuga reptans OX=38596 GN=GOLS2 PE=1 SV=1
sp|Q9FXB2|GOLS2_ARATH	2.60e-06	175	260	50	134	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1
sp|O22893|GOLS1_ARATH	3.59e-06	175	260	58	142	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999194	0.000842

TMHMM  Annotations     

Start	End
7	29