CAZyme Information: SMR64317.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR64317.1
• CAZy Family: GT39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836		90807.46	5.5984

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854284:1460781-1463345(-)

Full Sequence      

MVANHQDFDVEDVLAQLTTSEKISLISGTDFWHLAGVPRLGIPALRTSDGPNGIRGTRFF
QGVPAACLPCGTALGATWDVDLIKKGGELMGRESIAKGASILLGPTVNMQRGPLGGRGFE
SFSEDPVLAGNMAAASINGIQSTGVAATLKHFVCNDQEDKRMSSNSILTERALREVYLLP
FQIAQRDAKPMAYMTAYNLVNGLHASENPKLLQDILRKEWGFDGLVMSDWFGIYSTTEAI
KAGLDLEMPGPSGLRGDQVTRAMGCGKVLKHHLDARVREVLKLIKKLIPLQIEENAVETT
INTPETSALLRSIASSSIVLMKNERSILPFKKEKSVAVIGPNAAFAAYCGGGSASLAPYY
AVTPLEGIRAKCKDAQYELGAPGWKSLPLLSNIAKTKTGERGLTMKLFLEPHSDPHRKLL
DEVIIDSTMISLFDYKNPKLDTFLFYGDVDCQITPEETHEYEFSCSVAGTAKVFVDGNLV
VDNMTKQVPGEAFFGIGTREEIGSIRLEAGKTYDVHVEFGTLPTITYKKEGVTAFGAGAL
RLGCYRKVNITDEIARAVALAEQVDQVVLVAGLNSDWESEGYDRPHMDLPPGSDDLINAV
LAANPNTAVVMQSGTPVTMPWADKAAAIVQAWYGGNETGNAIADVIYGNTNPSGKLSLSF
PKRNEDNPAFLNFTSDDNRVLYGEDVYIGYRFYEKTKREVLFPFGHGLSYTTFFLGTPHI
SSSADSDEVIVSIDVSNTGNLAGAEVVQVYVAPKSPSIVRPVKELKGFVKVFLEAGETAK
AEVKLSKKYATSFYHEGRDGWVSEKGRYTVLVGTSSKNTPRSAVLEIEETVFWKGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	249	4e-71	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.77e-82	39	819	101	757	beta-glucosidase BglX.
224389	BglX	3.83e-75	29	343	47	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	9.03e-59	318	710	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	6.15e-47	39	283	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.32e-42	17	783	60	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR64317.1|GH3	0.0	1	836	1	836
SMY29662.1|GH3	0.0	1	836	1	836
SMQ55981.1|GH3	0.0	1	836	1	836
SMR61167.1|GH3	0.0	1	836	1	836
UJO24157.1|GH3	0.0	5	836	3	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.04e-270	8	836	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.75e-264	8	836	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	7.27e-139	9	831	4	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.24e-121	17	828	12	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	9.64e-110	12	827	56	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	0.0	8	836	4	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	9	836	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1DFA8|BGLI_NEOFI	0.0	9	836	5	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	0.0	9	836	5	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	0.0	9	836	5	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999848	0.000201

TMHMM  Annotations     

There is no transmembrane helices in SMR64317.1.