CAZyme Information: SMR63840.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR63840.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657		72378.03	9.4870

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854283:1565114-1567449(-)

Full Sequence      

MASPKRNHIFISPMSCTRSCIPGCDRTSNAAPAKVRPRGSSNSAKIIPSEFDCACKDGIH
TKKLAMHEVYARTGDKHQAIPPPAEESQAITEHLVDMIRKRSQKSMYKVLGAGLSSELAA
LNPQLPLMRWARLDIFLMTLAARAAVTSAHSLETGNEKIAFFGATPQGGGVALKRHALLR
YLDLVGVDCTRYVPTPEPEVFRLRRIRIGTASLISADLRFSGAKEKSVDDFAKTNVKRLW
TGGGMPLAPRSNGGADTNIVNAHQTTARTSIAEDLDPTRPVICRAHIQIRTELIQDPTSA
TSPLWNWLWSHVKKADLFIAHPFAACIPHFVPKDKLAYFPATTDRPDGIKKNISDSDIQY
HLEIFGAACFRERLSTPTYPKRDYIVQIARFDPAKDINNALDAYAEFRRNSAFCHRKPTS
GTPQLVLRGHASVHDPDGSTVFNEALDRLKRYPELRDSVIIVRLGPGDQLPNCLLSRARV
ALQYGTMSTQHNVSDHNVPTRYNVAPGTAYGACSTRGKKILEVFMVVGWIFLAVGGRLPN
PLARLIVSGIGTVVSVVCDGLMSDCIPWYVWTTWVRVVGQLAVAIVGILWDSWAYLEERR
IQAKIDRLEELNSTVVVGRTGWTTSSTNIALSDMPVGLRRRDPSGSASTEVTDQGEV

Enzyme Prediction     

EC	2.4.1.231:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	3.32e-71	158	483	1	285	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR63840.1|GT4	0.0	1	657	1	657
UJO15984.1|GT4	2.34e-100	144	486	226	571
CBY00763.1|GT4	2.24e-92	144	486	238	581
QDS69987.1|GT4	3.69e-91	57	486	76	574
QKD59362.1|GT4	1.04e-88	149	486	216	552

PDB Hits     

SMR63840.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6YRN9|TREPH_PLEPU	1.04e-69	144	486	264	606	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|O75003|TREPH_GRIFR	4.58e-68	144	486	260	598	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|Q9UV63|TREPH_PLESA	8.00e-66	133	486	250	618	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1
sp|Q7LYW5|TRET_THELN	3.97e-08	141	449	25	287	Trehalose synthase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) OX=523849 GN=treT PE=1 SV=1
sp|Q9HH00|TRET_PYRFU	3.97e-08	141	449	25	287	Trehalose synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=treT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SMR63840.1.