CAZyme Information: SMR63200.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR63200.1
• CAZy Family: GT57|GT57
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552		61192.22	5.9526

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854282:1601343-1603440(-)

Full Sequence      

MIVAANRRSWSTVGVLLLTTIWTYVWFASWKVSTANLAWSRNIQSSKIAQAGPGASNDTL
GFGAIYVLTENTTTWRVQGLIRAANLTGLSIQIPVQDHISDEAVLAHTGKEPTEGYGHAR
ALLNHLSLLETFLASDHSTALIFEDDVDFSIHIRSQMSLISGAFYNHSAQNPESRHLDPY
LHSTWDIFWPGHFGMQFADNVDIFHYKDSHALPWAHLTSEFNNYYTQMAETTPPEDQQLV
FNVAPLATFAYAITRSHAAKLLSKLRSDRAEKFDNALHVECKGLWQRCVAPVPQVFHHHQ
VEGEKSLSSEEGRKEEVEGELGWYMRRHKWTYNVEWSARCNALETGTTPLAPEVFNVFQR
LIRFSTTFLILTGLVSALSTGVLQLQEFHPTTTTLQRLAEGFFVSSTATAVIAAMLATML
LFRFEGYVQASRKDLCLAWSPLVILDWSILSFLAGLLTWYTDKNPDFRSSLVGPMTGVGL
AFCLWVAVDMWFTIRRPGGLGKEELEIIDGMKTGGGQGRGEESSEAVHAVGVGVESVTGE
AAEAADVGNGSS

Enzyme Prediction     

No EC number prediction in SMR63200.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.15e-04	97	152	45	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR63200.1|GT25	0.0	1	552	1	552
SMY28582.1|GT25	0.0	1	439	1	439
SMQ54925.1|GT25	1.55e-255	1	346	1	346
SMR59364.1|GT25	8.94e-255	1	346	1	346
EAA60052.1|GT25	4.85e-34	55	343	41	329

PDB Hits     

SMR63200.1 has no PDB hit.

Swiss-Prot Hits     

SMR63200.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999979	0.000020

TMHMM  Annotations     

Start	End
10	32
364	386
401	423
435	457
472	494