CAZyme Information: SMR56264.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR56264.1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	LT854278|CGC15	69081.76	5.7377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854278:1497425-1499272(+)

Full Sequence      

MRRPTTGRCFAWFISVTLVYIVLSLLGHQITKSAPGEEVQSNAEWVNSGKYWLDRQACRW
FGLCGTMHMLNKDAWTWTKAEADDPDNRDISDWWTSGTDDPEKWTKEEIKLRKIPQYVLD
HAPYVHLFSGEQFWPGDLSEHLIHTTPFLNYSRISDLDEERNLTNLHELNDYAEGKHSRF
MYLGALDNVEERPKWLVGGKNIPKMPAQNDGDLDLDYPWPDPNDDLKDFDLEAAKQQTLD
DFYHKEGISTKGEVPAEHLPSDRTASLDGRCGGNSGYTCTGSKFGTCCSIYGWCGTSPAF
CGEPCDPLAGTCHDPYAIPQGPHPDLRRRDHDPTLDNPSHKPQPGGKSSAPAILIVVPKP
DGVVDAFWFFFYSFNLGQTVLNIRFGNHVGDWEHTTVRFVNGKPTQIFLSEHNFGQALTY
SAVEKYIPSHDSTGTMIGSWSNATAASRAKRPVVYSALGSHAMYATPGLHPYILPFGLLH
DETDRGPLWDPVQNFQAYTYNPLTRTVRSSTLNPTSPTQWFDFAGHWGDKFYELGDPRQY
RFAGQYHYVNGPTGPKFKNLGRRAVCQSGRRGCEVRRFARNERGATATNPEEEEGEDGEV
GGLPGGNVTDEAWGV

Enzyme Prediction     

No EC number prediction in SMR56264.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	2.61e-17	270	312	1	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
399239	Vps62	2.09e-12	366	559	339	533	Vacuolar protein sorting-associated protein 62. Vps62 is a vacuolar protein sorting (VPS) protein required for cytoplasm to vacuole targeting of proteins.
211311	ChtBD1	1.60e-10	270	307	1	36	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	1.85e-10	270	305	1	34	Chitin recognition protein.
214593	ChtBD1	2.60e-06	270	305	1	34	Chitin binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR56264.1|CBM18	0.0	1	615	1	615
SMY25446.1|CBM18	0.0	1	615	1	615
SMQ51802.1|CBM18	0.0	1	615	1	615
SMR54167.1|CBM18	0.0	1	615	1	615
UJO22070.1|CBM18	7.79e-292	2	612	6	604

PDB Hits     

SMR56264.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q06466|TDA6_YEAST	7.76e-49	345	584	177	420	Putative vacuolar protein sorting-associated protein TDA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TDA6 PE=2 SV=1
sp|P53285|VPS62_YEAST	5.39e-48	345	587	181	423	Vacuolar protein sorting-associated protein 62 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS62 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000000

TMHMM  Annotations     

Start	End
9	31