CAZyme Information: SMR55997.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR55997.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	LT854278|CGC4	74515.24	7.1705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854278:683953-686389(+)

Full Sequence      

MTIPDEVDIIVCGGGSCGCVVAGRLANLDHKLQVLLIEAGESNLNNPWVFRPGIYPRNMK
LDSKTASFYYSRPSEWLSGRRAIVPVAHILGGGSSINFMMYTRASASDYDDFQAKGWTTK
ELLPLMKKHETYQRACNNRDIHGFDGPIKVSFGNYTYPVMQDFLRAAESQGIPTTDDLED
LQTGHGAEHWLKWINRDTGRRSDSAHGYIHSTRAVHQNLHLQCNTKVDKVIIENGRAVGV
RTIPTKPLHPTENISRTFKARKQIIVSGGTLSSPLILQRSGIGNPEKLRKAGVKPLVDLP
GVGLNFQDHYLTFAPYRAKAWADSFDDFVRGDKETQEKVFAQWELNGTGPLSTNGIEAGV
KIRPTEKELQEIDSWPMNEFRSGWDSYFKDKPDKPVMHYSVIAGFFGDHMQIPPGKYFTM
FHFLEYPFSRGHIHITSPNPYEAPDFDAGFMNDRRDMAPMVWGYIKSRETARRMDAYAGE
VTAMHPFYAFDSPARCHDLDVAETNAYAGPNHITSNIQHGSWTTKKLPGRAPQTTHLNSN
DQPIQDDLQYTKEDLLAVEEWTKRHVETTWHSLGTCSMAPKNGNSIVKHGVLDERLNVHG
VKGLKVADLSICPDNVGCNTYSTALLIGEKCAMLTAEDLGYTGRALEMRVPEYHAPKETV
GLSRL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	640	2.6e-261	0.9983050847457627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.34e-82	6	632	5	528	choline dehydrogenase; Validated
225186	BetA	1.26e-72	1	638	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	3.90e-47	79	310	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.93e-25	427	631	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.00e-12	8	628	57	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR53626.1|AA3_3	0.0	1	665	1	665
SMQ51538.1|AA3_3	0.0	1	665	1	665
SMR55997.1|AA3_3	0.0	1	665	1	665
SMY25177.1|AA3_3	0.0	1	665	1	665
CAE6999707.1|AA3_3	0.0	1	665	1	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	0.0	1	664	1	662	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	1.18e-243	4	656	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	1.93e-242	4	656	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6ZH7_A	2.82e-47	3	634	4	559	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	5.27e-47	5	634	6	559	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P04841|ALOX_PICAN	0.0	1	664	1	663	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	0.0	1	664	1	662	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2QY27|ALOX1_KOMPC	0.0	1	664	1	662	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|F2R038|ALOX2_KOMPC	0.0	1	664	1	662	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|P04842|ALOX1_KOMPG	0.0	1	664	1	662	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SMR55997.1.