CAZyme Information: SMR54792.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR54792.1
• CAZy Family: GH32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	LT854277|CGC15	43190.33	4.6141

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854277:2618817-2620073(-)

Full Sequence      

MGVYTVAALLASGLLANAVPHAGNEHQHAHLHKRHSNYTVPAVVVQADECAYETYTKTWY
GEPTMAMDTPASTYVAPPPASTYVAPPPASTYVAPPPATTSKAPPVYVAPTPATYEAPVS
SSAPAYSAPAYSVPAIAKQVLNDVHAAITPSGNKWAMTYTPYAQDGTCKSASDVASDIKS
IKSMGFTTVRIYATDCSGPENVGAACAAEGLKIILGVYIDGSGISGTCHEQISTLTTWGA
DNWSMVEMVVVGNEAVFQGHTDAGSLAAFISDTKSKFQAAGYTGPVTTTETVAVIVENAA
IFCPVIDCVAANIHPYFNGAVAASGAGDFVKTELALLESACPGKDTYNLETGWPSAGNAN
GAAIPGTAEQKEAIDSIVAVCGSKSAIFSFENDTWKAAGNLGVEQYWGASSVFAAPSY

Enzyme Prediction     

No EC number prediction in SMR54792.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	174	410	5.5e-17	0.9131832797427653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.29e-62	116	409	9	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
252669	Extensin_2	1.81e-05	74	129	3	54	Extensin-like region.
411345	gliding_GltJ	1.82e-05	63	140	404	481	adventurous gliding motility protein GltJ. Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.
411345	gliding_GltJ	3.82e-05	65	150	391	474	adventurous gliding motility protein GltJ. Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.
237865	PRK14951	1.68e-04	78	150	366	438	DNA polymerase III subunits gamma and tau; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY24882.1|GH17	4.82e-275	1	418	1	418
SMR54792.1|GH17	4.82e-275	1	418	1	418
SMR53139.1|GH17	4.82e-275	1	418	1	418
SMQ51237.1|GH17	4.82e-275	1	418	1	418
USW54901.1|GH17	4.02e-117	5	413	5	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.84e-09	165	357	46	230	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.20e-08	165	357	46	230	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9Q9|BTGE_ASPFC	1.16e-84	157	413	311	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	1.16e-84	157	413	311	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	1.97e-82	152	413	293	551	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	4.69e-82	151	413	343	601	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	4.69e-82	151	413	343	601	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999696	CS pos: 18-19. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in SMR54792.1.