CAZyme Information: SMR52052.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR52052.1
• CAZy Family: GH27
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
624	LT854276|CGC12	67320.72	4.8996

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854276:2139377-2141450(+)

Full Sequence      

MRYSAVWLSALLCLRTELVSAEHATGQGKRQLLNADILGAQTYDYVIVGGGTAGLAIANR
LSADASITVAVIEAGSLYQVTNPLLSTFPAGDVFFVGSDPKQPLDVQPLVDWNLVTEPQA
GANERKFRYARGKCLGGTSARNFMIYQRPTKGSLQQWADAVDDQSYTFDEWLPDFKRSVD
FTPPGPTRATNASAEYNAAAFDSGAGPLQVSYSNYAGPFSSWVEGSLNEIGIGHAQDFNS
GSLMGAQYCSSTIRPKTQSRETSQTSFLNAATTRSNLKVFSATKAKKILFDAEKKATGVR
VTTALNLVGLTINARREVIVSGGAFHSPQLLMVSGIGPASTLRQHGIEVISDLAGVGQNL
IDHILFGPAYRVKVDTLSRIVQDPVYLAAQVLEYAQQRGPLANPVCDFLGWEKVPNSLRE
SLSSSSIAELDRFDADWPEIEYLGAPGYVGAFTNLFATQPDDGYQYATILAALVAPTSVG
SVTISSDDTDDLPVIDPNWLSTKTDQEVAIAAYKRVREAFASNFMKPVLADDEEYFPGPD
VQTDAQILEVIRNTLQTVWHASGTCKMGRASDNMAVVDSRARVFGVTGLRVVDASSFALL
PPGHPQSVVYALAEKISRHILSDD

Enzyme Prediction     

No EC number prediction in SMR52052.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	41	622	6.6e-185	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.52e-102	40	623	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.09e-100	41	621	4	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.69e-43	476	616	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.22e-28	39	623	52	579	Protein HOTHEAD
366272	GMC_oxred_N	1.31e-25	122	363	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY23809.1|AA3_2	0.0	1	624	1	624
SMR52052.1|AA3_2	0.0	1	624	1	624
SMR51115.1|AA3_2	0.0	1	624	1	624
QDS73883.1|AA3_2	1.48e-276	27	623	22	608
UQC81385.1|AA3_2	9.24e-270	21	622	30	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	1.46e-56	40	615	5	555	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	2.79e-56	41	615	6	555	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	3.86e-56	41	615	6	555	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	5.34e-56	41	615	6	555	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	7.10e-56	41	615	22	571	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	1.30e-189	39	617	47	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	9.52e-179	41	620	50	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.81e-163	33	617	31	604	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.04e-159	43	623	36	610	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q12062|AFLK_ASPPU	4.14e-147	41	622	73	641	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000847	0.999162	CS pos: 21-22. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in SMR52052.1.