CAZyme Information: SMR51855.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR51855.1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643		69771.00	5.3069

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854276:1500417-1502348(-)

Full Sequence      

MAVHSLLASLLSLPLAVATLAADKSPPKGGISHVQHPRDINTTYDYIIVGGGTSGLTVAN
RLTAHAHVSVLVVEMGQIDNGERVLLPYTTNVNSFHDLAPVTSMPLKHLSNTPYFVAAAA
TVGGGSVINGMFFDRASAADYDAWEQLGNPGWGFDDLLPYFIKSTNWSVPSPEIAEMYNY
TWDESCWGQSGPIHSSIPPFQWPELPTFLQAWREMGDDIRFPEEGNDGSGLGVMWVPSSQ
DPTTQTRSSAKTGYYDPIADRSNLHLLTQTRVEKVNFKGKTAVGITMTSLLDSKTYKASA
RKEVIMAAGPVFSTNLLHKSGIGPQGMLEAAGIEVIEDLPGVGTNFQDHPALYMYWDLLN
DTYPSPGLLQSNTTFFREARDEYDKSRSGPLIQPHGNNAAFLSLRTISPDVDEIVAQIAA
QDPSRYLPDSYDFTSRIGYAAQHAILVDRLGGTKSAVYEMTFNGGKMVANAFQKPLSRGT
IVLNMSDPLLGPQVDYNTLANPMDGIITVAMLNYTRKFYQTPSMQSLGASETIPGPGYVS
TEDILKQFQQRLLSPSFSHPSCSNPMMPLALGGVVSPELLVYGVERLSVVDVSIMPMIPA
THLCGTVYAIAEKAADLIKARNSEGDVCDTGPPSNCRKQKGRS

Enzyme Prediction     

No EC number prediction in SMR51855.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	43	620	2.6e-157	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.41e-77	37	622	1	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.01e-74	41	621	3	534	choline dehydrogenase; Validated
366272	GMC_oxred_N	2.71e-30	44	351	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	8.55e-24	475	614	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.59e-14	41	607	53	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR50915.1|AA3_2	0.0	1	643	1	643
SMR51855.1|AA3_2	0.0	1	643	1	643
SMY23609.1|AA3_2	0.0	1	643	1	643
SMQ49927.1|AA3_2	6.80e-252	1	352	1	352
QRD00954.1|AA3_2	5.38e-161	41	621	22	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	2.88e-129	18	618	12	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	6.43e-123	39	619	1	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	2.13e-64	42	619	4	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	3.90e-52	43	620	16	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5OC1_A	7.53e-46	44	620	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	8.77e-127	38	622	31	617	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	5.27e-74	43	618	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	5.27e-74	43	618	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|P0DO29|ERIK_HERER	7.35e-66	41	619	31	596	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	1.28e-63	34	622	31	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000825	0.999158	CS pos: 21-22. Pr: 0.9216

TMHMM  Annotations     

There is no transmembrane helices in SMR51855.1.