CAZyme Information: SMR51826.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR51826.1
• CAZy Family: GT69
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392		42973.41	6.5492

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854276:1410539-1411833(-)

Full Sequence      

MGSHRHKLTELVREATSSVIAHSERLSGHRDKNRTPASAGRVVVYHQTHHQPNDGPPVSL
LPLISNNTGVTHVIIAAIHLNDPAGNITLNDHPPDHERFNTLWGEVAWLQASGVKCMGLL
GGAAQGSFGRLDGEDVARFESYYIPLRDMIRKHGLNGLDLDIEEPTSLPGTIRLIDRLRA
DFGSDFIITLAPVATGLLPNQPHLSGPAFEYRQLEQMRGHEIAWYNTQFYCGWGDAGTTS
WYDAIISVGWNPSKVVMGLITNPANGAGHVEWPRQRPVLQALRQKYPNFGGVMGWEYFNA
LPGGNEKPWEWVKNMGDAMGAPIVHPPPPQQQVPFRPYGQPGPAQLPQPAHNFPAESIAT
LKDLGFNEQQAVAALNSTGGNVEYAAGLLFQD

Enzyme Prediction     

EC	3.2.1.96:2

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	1.18e-145	41	300	1	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	6.46e-16	42	230	1	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
270494	UBA_scDdi1_like	4.04e-13	356	390	2	36	UBA domain found in Saccharomyces cerevisiae DNA-damage response protein Ddi1 and similar proteins. Ddi1, also called v-SNARE-master 1 (Vsm1), is a ubiquitin receptor involved in regulation of the cell cycle and late secretory pathway in Saccharomyces cerevisiae. It functions as a ubiquitin association domain (UBA)- ubiquitin-like-domain (UBL) shuttle protein that is required for the proteasome to enable ubiquitin-dependent degradation of its ligands. For instance, Ddi1 plays an essential role in the final stages of proteasomal degradation of Ho endonuclease and of its cognate FBP, Ufo1. Moreover, Ddi1 and its associated protein Rad23p play a cooperative role as negative regulators in yeast PHO pathway. Ddi1 contains an N-terminal UBL domain and a C-terminal UBA domain. It also harbors a central retroviral aspartyl-protease-like domain (RVP) which may be important in cell-cycle control. At this point, Ddi1 may function proteolytically during regulated protein turnover in the cell. This family also includes mammalian regulatory solute carrier protein family 1 member 1 (RSC1A1), also called transporter regulator RS1 (RS1) which mediates transcriptional and post-transcriptional regulation of Na(+)-D-glucose cotransporter SGLT1.
395573	Glyco_hydro_18	7.38e-13	68	259	21	220	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	2.62e-11	105	295	65	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY23583.1|GH18	6.38e-301	1	392	1	392
SMR51826.1|GH18	6.38e-301	1	392	1	392
SMQ49901.1|GH18	2.60e-300	1	392	1	392
SMR50887.1|GH18	5.24e-300	1	392	1	392
UJO12460.1|GH18	7.04e-205	41	392	13	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8V_A	9.41e-113	41	319	14	288	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]
4AC1_X	3.75e-81	41	313	4	273	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]
2MR9_A	4.38e-06	353	391	5	43	NMR structure of UBA domain of DNA-damage-inducible 1 protein (Ddi1) [Saccharomyces cerevisiae S288C],2MRO_B Structure of the complex of ubiquitin and the UBA domain from DNA-damage-inducible 1 protein (Ddi1) [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2H085|DDI1_CHAGB	1.61e-06	350	392	402	444	DNA damage-inducible protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=DDI1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000014

TMHMM  Annotations     

There is no transmembrane helices in SMR51826.1.