CAZyme Information: SMR49799.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR49799.1
• CAZy Family: GH142
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835		89012.75	7.5894

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854275:1585875-1588784(-)

Full Sequence      

MHFSQWLLPLLAASSTNAQIFVPQAVQQLQQQALSTFSNYTNYNGPSTSALNALRPNTQS
QMQVQSQSISAAAASCDFWMESIGHRGVAAFNSNPSGYQVFRNVKTFGAEGDGVTDDTAA
INAAISSGSRCAPGSCGSTTTTPAVVYFPAGTYVVSASIIQYYYTNLIGNPLPGCMPVIK
ASPRFSGGLGVIDSNPYQAGGALGYGATNVFWRQIRNLVIDMTAVPASSAITGLHWPSSQ
ATSLQNLVFKMSSASGTQHQGIFCESGSGGFMNDLIFYGGRYGANWGNQQFTTRNLTFYN
AQTAINQIWDWGWTYQNININNCSIGLDMSGLDTNGAQTVGSVTFIDSTMANTAIGIKTA
RSSSSQPNAGGSLVVENVRLSNVRTAIQGPGGALVGAVSSIAGFLQGNTYTPTGPNKAQG
SFTPNSRPSSLLQLDGKYYQRSKPQYERLSTSSFLSARSAGATGNGRTDDTTALQNAINS
AKSQGKVLYLDHGDYLVSKTIYIPAGSKIVGEVFPVILSTGSFFNNVSNPQPVVKIGNTG
ESGSIEWSDAIVSTQGKQVGAILIQYNLVAPAGTPSGLWDVHTRIGGFAGSNLSLANCPK
TPGTTASVSAINANCISGYLQLHINRNSTGLYLENVWLWTADHDVEDNALRQITIYTGRG
LLDQSTNGPVWMVGTGVEHNQRYQYQFGGANNVYAGQIQTETAYYQANPNARLPFPVVTA
LNDPQYPSNDFITDGDKSNIPAANGWGLRVANSGNIFIYGAGEYSFFNNYSTSCSDQGSG
AVCQSRITSIENSKVNIYNHNTVGTRFPLSLNGVNQIRWSDNQNGFIQTEALFRN

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	70	833	1.8e-265	0.9905405405405405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	3.38e-91	101	328	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.59e-06	454	523	1	74	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	2.74e-04	103	385	84	400	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR49799.1|GH55	0.0	1	835	1	835
SMQ48798.1|GH55	0.0	1	835	1	835
SMY22500.1|GH55	0.0	1	835	1	835
SMR48618.1|GH55	0.0	1	835	1	835
USW52588.1|GH55	0.0	14	835	15	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	2.72e-211	71	829	19	751	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	7.58e-208	74	834	2	754	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	2.08e-226	71	822	40	773	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	2.00e-201	78	833	43	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	6.61e-48	143	830	97	743	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999732	CS pos: 18-19. Pr: 0.9714

TMHMM  Annotations     

There is no transmembrane helices in SMR49799.1.