CAZyme Information: SMR47778.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR47778.1
• CAZy Family: GH109
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		57118.97	4.3416

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854274:2792874-2794579(-)

Full Sequence      

MASKYALPILAMIGLAAAQGNSTCPDYSDYSKELHGPYSEGRYQLSYQRPETSCRTFQSS
VVESAITDVTGKIADPDLKRLFENTYPNTLDTAVKWRGTAAGSDEELCFLITGDINAMWP
RDSTNQVKAYLPLLKADSSPDSLASIYRGVINLQARFLRTSPYCNSFQPPVESGLGASFN
EYATTDVVTPTYSNLSVFECKYELDTLAAFLEVSDNYYNATQDIEFFRKYSWVDAVKAVL
KVAEEMMVPTYADDGSVNKLAYSWTRQSDRSTETTANGGLGNPFNNVTGLIRSFFRPADD
TTIYMGFIPANMMFARYLESAAIIMSALGDQNDLANQMTTLAENLRCAITKYGIVQTSEF
GPIYAFEVDGYLGQNIMDDANIPSLLSAPFFGYLSADDEVYQNTRKLILSERNPYYMIGP
RLSAVGSPHTGPGKAWPMASIVRIATSNDDDEITEQLREILSTTDGLGLIHESINTFNTT
DYTRQWFSWANSLFGQVVLDLANRKPEVLQQSFQ

Enzyme Prediction     

No EC number prediction in SMR47778.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	75	499	4e-157	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	75	499	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	2.05e-146	53	509	1	430	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
225922	SGA1	0.008	215	476	363	579	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR46535.1|GH125	0.0	1	514	1	514
SMQ47990.1|GH125	0.0	1	514	1	514
SMR47778.1|GH125	0.0	1	514	1	514
SMY21681.1|GH125	0.0	1	514	1	514
AQA29358.1|GH125	3.02e-253	1	514	1	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	5.96e-87	49	514	23	461	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.01e-85	49	514	43	481	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	4.16e-84	49	514	21	463	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	2.66e-76	61	507	11	429	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	5.94e-76	61	505	11	427	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	7.83e-137	24	512	27	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999815	CS pos: 18-19. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in SMR47778.1.