CAZyme Information: SMR47185.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR47185.1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836	LT854274|CGC12	95545.02	5.7305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854274:1122662-1125221(+)

Full Sequence      

MAQPMQVATLTTGWSFKQTDTEDWLDVARVPTNVHLDLLDQKKIEDPFLGFNELKCEWVG
EKSWTYKVSLPEVSKAQPGTKHVLAFDGLDTFATVKLGGKTILESDNMWIVHRVDVTDDL
KPDRDNVLEIEFKSALLEARKIKDAHPEHKWVGFNGDMARLAVRKAQYHWGWDWGPVLMT
CGPWRQVRLETYQARVADLRVDYDVDANFRKVSGSITAHVEGHSGQAVNFEAKFGGEIVF
MGTAEVDDKGQAKVEFHIKEPKLWYPHGYGEQPLYDITATVTSGEHALHSVSRRTGFRKG
ELIQEPDEIGKTFFFRINGIDVFCGGSDWIPADSFTPRVNEEKYRKWLQTMVDGYQVMIR
IWGGGIWEEDCFYDIADELGVLVWQDFMFGCGNYPTFPETLKSIEEECVCQTKRLRHHPS
IVIYAGNNEDYQVQEQCGLAYDYEDKDPQSWLKTDFPARYIYEKLLPDVVAAHTPHVPYH
PGSPWGDGKPTTDTTVGDMHQWNVWHGTQEKYQIFDTLGGRFNSEFGMEAFPHIETIKHF
VTDPTQLYPQSHMIDFHNKADGHERRIATYLVENFRTETDLEKFIHLTQLSQAEALMFGY
RGWRRQWGQKRFCGGALLWQLNDCWGVISWSIVDYFLRKKPAYYAVRRVLAPIAVAVKRA
HHDWSVVHARPAKSLDYECWVASFKTTEVTATVELRYISIATGKEIKDKVVKKDIKIVAN
GTTDVLKGTIDNVNEEAHVLAARIWVNGEIVSRDVDWPQPLKYLDLSDRGVEVQSEGNTI
TLSAQKPTKGLVFEEREGVLVNDSAIDIVPGDEQLVQVRGLGPNDPSLRWTYLGKP

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	731	7.1e-85	0.6954787234042553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.48e-72	3	660	7	639	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	2.24e-13	194	298	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407658	Mannosidase_ig	6.80e-10	676	763	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR47185.1|GH2	0.0	1	836	1	836
SMR45932.1|GH2	0.0	1	836	1	836
SMY21082.1|GH2	0.0	1	836	1	836
SMQ47400.1|GH2	0.0	5	836	1	832
UJO13387.1|GH2	0.0	1	836	10	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.87e-140	5	658	24	661	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	6.89e-120	5	818	3	832	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	7.05e-120	5	818	3	832	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	4.92e-119	5	818	1	830	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	5.04e-119	5	818	3	832	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB7|MANBB_ASPOR	0.0	10	835	9	844	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|Q5B7W2|MANBB_EMENI	0.0	10	835	9	843	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|Q0CCA0|MANBB_ASPTN	0.0	9	835	8	843	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A2QYN2|MANBB_ASPNC	0.0	9	835	8	844	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	0.0	5	835	4	845	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SMR47185.1.