CAZyme Information: SMR45057.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR45057.1
• CAZy Family: AA8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
929		104867.16	4.4873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854273:4742343-4745237(-)

Full Sequence      

MRCIVAVAISLCVNTIASKDRSLEGNDWTLSNALLNISVPAELPSSAHLDLLASQVIGDP
LYGANNYNLRWIVWQNWTYTSAPISDLTSNASSTWLLFNGLDTFTSISFCGRHVASTNNQ
FRQYWFDVSEILSSCNETDRVLDINFGSAPTIADEIANQPGQETWPEGVQQLYQFPNRWF
IRKEQSDFGWDWGPAFSPTGPWQPAWVIQLVDEEVKVRNTLIDIYRQGQLNNIPPDQSQS
WVVNASLDYFGQMPEGATMTYRLMSLDNQTTIASGALNNVVITDSTATGDTIVPSSVVDL
WWPIEMGDQVLYYLTINLVSARNSTLATVTKRVGFRTIVLNSNPISNEQLAQGIAPGNNW
HFEINGREFYAKGSNFIPPDAFWTRVTPERISNLFDTAIAGNQNMLRVWSSGAYSPDFMF
DLADEKGLLLWSEMEFACALYPVAPEFLDNARQEAEYQVRRVNHHPSLTFWAGGNELENL
ELYLVNQSAPEQYDRYLAEYEKLFLETLLPVVYGNTRSISYQPSSTSNGWLTLNHSAPMP
MVQRYNNKTEGSIYGERDYYNYDPASLGNASTYPVGRFSNEFGYHSMPSIQSWRQQVAER
DLQFNSTVILQRNQHNPPGNLSTMNLGNSLAGQGQMTQAVEMWYPIPSKQNAAANFSAWC
HATQIFQAEFYTSQIEFYRRGSGLPERQLGSLYWQLEDLWVAPTWSSVEYDGRWKVLHYA
AKDRYEHVIIAPYFNRTTGNLSVWATSDLWDSVQGKATLTWYDWSGTKLDVGSNTSFVDV
TIGAINSTKIMDTNTTELLYGLDVNNAILRLEVEVEGKLPNSNATRTFKHENWFHPAPLK
DAKLVDPGLVYSFSYSDGGKIMITATKGVAAWVWIDYPADVVMHFDKNAFWLLPNETVEI
GFTVVSDGTNGKWPADVTVQSLWNQTLPE

Enzyme Prediction     

EC	3.2.1.25:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	17	783	2e-67	0.6848404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.69e-42	18	720	10	625	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407625	Ig_mannosidase	6.69e-19	846	924	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
407658	Mannosidase_ig	2.79e-15	739	841	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
236673	ebgA	3.69e-08	213	476	212	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR45057.1|GH2	0.0	1	929	1	929
SMY20222.1|GH2	0.0	1	929	4	932
SMQ46536.1|GH2	0.0	1	929	1	929
SMR42887.1|GH2	0.0	1	929	1	929
UJO11998.1|GH2	0.0	22	927	26	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVU_A	0.0	28	928	38	942	Structure of Fungal beta-mannosidase from Glycoside Hydrolase Family 2 of Trichoderma harzianum [Trichoderma harzianum],4UOJ_A Chain A, BETA-MANNOSIDASE GH2 [Trichoderma harzianum],4UOJ_B Chain B, BETA-MANNOSIDASE GH2 [Trichoderma harzianum]
6DDT_A	3.94e-102	22	893	13	836	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
2VJX_A	7.57e-78	28	903	15	817	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	7.82e-78	28	903	17	819	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	7.95e-78	28	903	17	819	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BCI8|MANBA_EMENI	0.0	13	925	16	924	Beta-mannosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndA PE=3 SV=1
sp|Q0CI48|MANBA_ASPTN	0.0	28	926	33	929	Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndA PE=3 SV=2
sp|Q2UN00|MANBA_ASPOR	0.0	15	927	18	912	Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndA PE=3 SV=1
sp|Q4WMS9|MANBA_ASPFU	0.0	23	927	27	924	Beta-mannosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndA PE=3 SV=1
sp|A1CTM5|MANBA_ASPCL	0.0	28	929	32	932	Beta-mannosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999722	CS pos: 18-19. Pr: 0.9491

TMHMM  Annotations     

There is no transmembrane helices in SMR45057.1.