CAZyme Information: SMR45046.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR45046.1
• CAZy Family: AA8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		51431.74	4.0523

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854273:4715339-4716912(+)

Full Sequence      

MQPALVKSLLITSFLWQSLVSAQQTCEGALTPSYVAPAVADGYTARLIADSLTEPRSIKF
DSQGALLVVQQNVGISVHTLVDGENDCLSIGSSKWLVNNTLLNHGIELSEDDTTLYASTQ
TALYSWDYDAEMQTVSSVNRTLVTGMTGTNHQTRTLLLPKSAPNLILISRGSKGNLDYET
VNVDSGVSQIKAFDMTNMTEPYDYVQDGLVVGWGLRNSVGVAEHPVDYGIWSVENSADEL
ERSGETVSRDNPAEEMNFHGFLNGTESPDFGQNFGYPTCFAAGAPSALPDFDGQVGDSFV
IGSLNDTNSDDSCTNQKPRLSFQAHSAPLDIKFNNAGTAAWMTFHGSWNRDDPTGYSLVV
VEFANGQPVESSTSTTAARSVVFTEDLSPCNGGDGTCIRPVGLAWDSKGRLFMTSDGTGE
LWVITRTDGSPTSGAGSNATGTIPESSGTETSSAAESSDTSTASLMSVGALPLAFVFSVL
AFVL

Enzyme Prediction     

No EC number prediction in SMR45046.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	29	424	2.2e-153	0.9900249376558603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	3.59e-14	108	429	136	399	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ46525.1|AA12	0.0	1	484	1	484
SMR45046.1|AA12	0.0	1	484	1	484
SMR42876.1|AA12	0.0	1	484	1	484
SMY20211.1|AA12	0.0	1	484	1	484
QDS74351.1|AA12	6.16e-150	14	434	13	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	7.23e-117	30	424	4	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	7.46e-117	30	424	5	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	7.71e-117	30	424	6	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	7.60e-65	25	426	4	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q44091|SNDH_GLULI	3.98e-11	114	428	172	445	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000323	0.999661	CS pos: 22-23. Pr: 0.9778

TMHMM  Annotations     

There is no transmembrane helices in SMR45046.1.