CAZyme Information: SMR44727.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR44727.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		37333.63	9.8712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854273:3840049-3841041(+)

Full Sequence      

MANLQFPYPRKSSVPTVSTSPRRSTYLRQRRAIRTYGPPLIGLTAIIWLLFYLFSTRPTT
ASTTLAIPPRPSNPPEVIIVTPLDPSLPQSFTSTIRANRNHYARLHNYATLFPSTHAYDL
LPNTPNSWSLVPSLRHAQTLHPHTPWIWHLSSTALIMNTTLSLDSRLLSPSVLPSLLLPD
TPVVPPDSVIHTPSHRNPASTSIILSRDATGLAHDSFLIRNSEWAKFFLDAWFDPLYRSY
NFQKAERHALEHIVQWHGTILGKVGLVQQRVLNGYVKQEEKGGEEAMYREGDFVANFWGC
GKEEGRASCEKEMGPMMEKWRGMRDAEGRS

Enzyme Prediction     

No EC number prediction in SMR44727.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	75	305	1.3e-61	0.975609756097561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	5.88e-64	75	301	3	233	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	1.07e-06	98	232	156	266	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR44727.1|GT34	2.46e-244	1	330	1	330
SMR42554.1|GT34	7.14e-228	1	330	1	330
SMQ46204.1|GT34	7.14e-228	1	330	1	330
SMY19892.1|GT34	4.13e-227	1	330	1	330
UJO11889.1|GT34	1.68e-122	1	327	1	322

PDB Hits     

SMR44727.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	4.43e-35	91	311	88	301	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	1.04e-27	69	300	97	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q10359|GMH3_SCHPO	9.83e-27	88	300	105	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|Q09174|GMA12_SCHPO	9.68e-22	69	300	97	333	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P46985|MNN11_YEAST	1.50e-21	70	319	153	418	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999982	0.000028

TMHMM  Annotations     

Start	End
32	54