CAZyme Information: SMR43885.1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: SMR43885.1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
872	LT854273|CGC5	99375.94	6.7832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiST99CH3D1	11991	1276537	0	11991

• Gene Location: location=LT854273:1609896-1612699(-)

Full Sequence      

MSTQKSELAVHQPTPNEHHAHFEQIAENRNGEQAVSLDTDPYAAPNVYYGASHNPRKVAK
SRTYSAIDHASRNTIATNYKTPGRRTSHDATGNAPRRFLIDVKDTLKTLLDREDTDGNVQ
ITIEDTGPKTIELGTAASGGYRRFDVRGTYMLSNLLQELTLAKKFGRKQIVLDESRLNEN
PVNRLARLIKDQFWPNLTRRIDGSNIATVARDPKDWTSDPRPRIYIPVGAPEQFQYYSRI
AREHPNMRLDVQWLKEGGADDDEYVRDLNNAPGLLAVAMERVQDTPHGEPDFKGLPFVVP
GGRFNELYGWDSYMETLGLLINGRSDLCVAMVKHFCFCIRHYGKILNANRSYYLRRSQPP
FLTDMALRVYDHIKSEPGSLDFLRDATLAAIKDYYTTWMSKPRFDEASGLSRYVPGGLGV
PPETEASHFVHVLTPYADKHGLDFKEFVNQYNSGQIKEPELDEYFLHDRSVRESGHDTSY
RLERVSAHLATIDLNSLLYKYEADIARLIRAFFGDRLTIPKEWQAPGKENFETSSTWDRR
AKKRRQIMDKLMWNEAKGMYFDYNTVEKQQTGYESATTFWAMWAGVATPRQAQVMVEKAL
PRFEVHGGLVSGTEESRGPVGVHRPNRQWDFPFGWAPQQILAWTGMLRYGFEEEAQRLAY
RWIYMVTKAFVDFNGIVVEKYDVTRQVDPHKVTAEYGNQGSDFKGVATEGFGWVNASYIY
GLQIMDTHMKRALGAVTTWDTFKRMTETQSGFDALLPGHAESHASTSPSGSHYLGTPGSS
DSGHNDVHLAAGKPTVFVKAQVVDHLHTVNEGDDNEQQHVTMEVPRHQEAMKSEEWVKLD
ESFEQNDEQHRQHKDRHHHHGHHHSSVNGGHE

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	165	724	1.4e-148	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	0.0	163	725	1	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	0.0	91	731	5	558	Neutral trehalase [Carbohydrate transport and metabolism].
215307	PLN02567	4.55e-48	281	715	122	534	alpha,alpha-trehalase
183934	treF	9.72e-48	231	715	87	536	alpha,alpha-trehalase TreF.
183936	treA	1.13e-43	296	715	150	526	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR43885.1|GH37	0.0	1	872	1	872
SMQ45338.1|GH37	0.0	1	872	1	876
SMY19044.1|GH37	0.0	1	872	1	876
SMR41695.1|GH37	0.0	1	872	1	876
UJO22789.1|GH37	0.0	1	762	1	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JTA_A	1.37e-283	34	735	21	730	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	2.64e-282	34	735	26	735	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5NIS_A	2.45e-277	101	735	6	635	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5M4A_A	3.42e-253	151	735	3	582	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	8.02e-34	296	754	115	531	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42622|TREB_MAGO7	0.0	38	747	15	725	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|O42783|TREB_NEUCR	0.0	35	747	15	733	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|O42777|TREB_EMENI	0.0	29	761	17	751	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2
sp|A0A384JRP0|TREA_BOTFB	0.0	34	744	12	723	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|J5K1E2|TREA_BEAB2	0.0	36	747	15	732	Cytosolic neutral trehalase OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=NTH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000010

TMHMM  Annotations     

There is no transmembrane helices in SMR43885.1.