CAZyme Information: SMAC_10417-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_10417-t26_1-p1
• CAZy Family: GT50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203		21231.42	4.8782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003544369:147-758(+)

Full Sequence      

MTGAIGDRSYGADPMQVAALGRATLDGLAAAGVVGIVKHMPGHGRARVDSHHELPRVDAS
DAELAIDLQPFVTLAHAPMAMTAHVVFSAWDADRPATLSPTVIREIIRERIGFDGLLMTD
DIDMKALSGTPAEKAAAAIAAGCDVVLDCWARMAEMTAIADRLDAIAPKSRARLDQAMAG
AGLGSEVPFAELVAKRDELLALA

Enzyme Prediction     

No EC number prediction in SMAC_10417-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	5	147	4.3e-34	0.6388888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.18e-43	1	177	129	304	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.54e-34	5	177	137	309	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	5.26e-33	4	182	131	309	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE91965.1|GH3	9.09e-93	2	203	133	333
QRY96410.1|GH3	9.09e-93	2	203	133	333
BCI70554.1|GH3	9.09e-93	2	203	133	333
UIJ47011.1|GH3	7.38e-92	2	203	133	334
APX66814.1|GH3	1.28e-90	2	203	133	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TEV_A	1.50e-28	5	146	145	290	The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
4GVF_A	7.90e-25	1	174	126	303	Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVF_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
4GVI_A	4.08e-24	1	174	126	303	Crystal structure of mutant (D248N) Salmonella typhimurium family 3 glycoside hydrolase (NagZ) in complex with GlcNAc-1,6-anhMurNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVI_B Crystal structure of mutant (D248N) Salmonella typhimurium family 3 glycoside hydrolase (NagZ) in complex with GlcNAc-1,6-anhMurNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3WO8_A	3.10e-23	8	128	141	264	Crystal structure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8],3WO8_B Crystal structure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8]
4G6C_A	3.99e-23	5	149	143	290	Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315],4G6C_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7NWB7|NAGZ_CHRVO	6.17e-27	5	172	137	319	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
sp|C4LEY6|NAGZ_TOLAT	1.18e-26	5	172	128	298	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
sp|Q8FIN2|NAGZ_ECOL6	3.62e-25	1	174	126	303	Beta-hexosaminidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=nagZ PE=3 SV=1
sp|A7ZKL1|NAGZ_ECO24	7.01e-25	1	174	126	303	Beta-hexosaminidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=nagZ PE=3 SV=1
sp|A1AA01|NAGZ_ECOK1	9.76e-25	1	174	126	303	Beta-hexosaminidase OS=Escherichia coli O1:K1 / APEC OX=405955 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999965	0.000096

TMHMM  Annotations     

There is no transmembrane helices in SMAC_10417-t26_1-p1.